Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RHH-RelE |
Location | 2718990..2719444 | Replicon | chromosome |
Accession | NC_002696 | ||
Organism | Caulobacter crescentus CB15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0H3CA69 |
Locus tag | CC_RS13115 | Protein ID | WP_012640512.1 |
Coordinates | 2718990..2719292 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0H3CAY6 |
Locus tag | CC_RS13120 | Protein ID | WP_024265819.1 |
Coordinates | 2719244..2719420 (-) | Length | 59 a.a. |
Genomic Context
Location: 2714574..2714915 (342 bp)
Type: Others
Protein ID: WP_010920362.1
Type: Others
Protein ID: WP_010920362.1
Location: 2714932..2715351 (420 bp)
Type: Others
Protein ID: WP_010920363.1
Type: Others
Protein ID: WP_010920363.1
Location: 2721678..2722556 (879 bp)
Type: Others
Protein ID: WP_010920374.1
Type: Others
Protein ID: WP_010920374.1
Location: 2715751..2716128 (378 bp)
Type: Others
Protein ID: WP_010920365.1
Type: Others
Protein ID: WP_010920365.1
Location: 2716196..2717146 (951 bp)
Type: Others
Protein ID: WP_010920366.1
Type: Others
Protein ID: WP_010920366.1
Location: 2717156..2717476 (321 bp)
Type: Others
Protein ID: WP_010920367.1
Type: Others
Protein ID: WP_010920367.1
Location: 2717741..2718358 (618 bp)
Type: Others
Protein ID: WP_010920368.1
Type: Others
Protein ID: WP_010920368.1
Location: 2718530..2718910 (381 bp)
Type: Others
Protein ID: WP_010920369.1
Type: Others
Protein ID: WP_010920369.1
Location: 2718990..2719292 (303 bp)
Type: Toxin
Protein ID: WP_012640512.1
Type: Toxin
Protein ID: WP_012640512.1
Location: 2719244..2719420 (177 bp)
Type: Antitoxin
Protein ID: WP_024265819.1
Type: Antitoxin
Protein ID: WP_024265819.1
Location: 2719468..2720301 (834 bp)
Type: Others
Protein ID: WP_010920372.1
Type: Others
Protein ID: WP_010920372.1
Location: 2720450..2721559 (1110 bp)
Type: Others
Protein ID: WP_010920373.1
Type: Others
Protein ID: WP_010920373.1
Location: 2722553..2723839 (1287 bp)
Type: Others
Protein ID: WP_012640513.1
Type: Others
Protein ID: WP_012640513.1
Location: 2723921..2724337 (417 bp)
Type: Others
Protein ID: WP_012640514.1
Type: Others
Protein ID: WP_012640514.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CC_RS13080 (CC_2505) | 2714574..2714915 | + | 342 | WP_010920362.1 | Grx4 family monothiol glutaredoxin | - |
CC_RS13085 (CC_2506) | 2714932..2715351 | + | 420 | WP_010920363.1 | acyl-CoA thioesterase | - |
CC_RS13090 (CC_2508) | 2715751..2716128 | - | 378 | WP_010920365.1 | hypothetical protein | - |
CC_RS13095 (CC_2509) | 2716196..2717146 | - | 951 | WP_010920366.1 | zinc metalloprotease HtpX | - |
CC_RS13100 (CC_2510) | 2717156..2717476 | - | 321 | WP_010920367.1 | zf-TFIIB domain-containing protein | - |
CC_RS13105 (CC_2511) | 2717741..2718358 | - | 618 | WP_010920368.1 | 30S ribosomal protein S4 | - |
CC_RS13110 (CC_2512) | 2718530..2718910 | - | 381 | WP_010920369.1 | hypothetical protein | - |
CC_RS13115 (CC_2513) | 2718990..2719292 | - | 303 | WP_012640512.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CC_RS13120 (CC_2514) | 2719244..2719420 | - | 177 | WP_024265819.1 | antitoxin protein relB-2 | Antitoxin |
CC_RS13125 (CC_2515) | 2719468..2720301 | - | 834 | WP_010920372.1 | S-formylglutathione hydrolase | - |
CC_RS13130 (CC_2516) | 2720450..2721559 | - | 1110 | WP_010920373.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
CC_RS13135 (CC_2517) | 2721678..2722556 | + | 879 | WP_010920374.1 | LysR family transcriptional regulator | - |
CC_RS13140 (CC_2518) | 2722553..2723839 | - | 1287 | WP_012640513.1 | DUF1254 domain-containing protein | - |
CC_RS13145 | 2723921..2724337 | - | 417 | WP_012640514.1 | host attachment protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11329.25 Da Isoelectric Point: 11.2666
>T229 WP_012640512.1 NC_002696:c2719292-2718990 [Caulobacter vibrioides CB15]
MGDARRKARARDVAQVVWTWRALADLTAIRDYIGQFSPLAAQRMALRLKTAADSLAEYPERGRLATATLRELVVVPPYVI
RYYVADGLVHIVRIRHAARL
MGDARRKARARDVAQVVWTWRALADLTAIRDYIGQFSPLAAQRMALRLKTAADSLAEYPERGRLATATLRELVVVPPYVI
RYYVADGLVHIVRIRHAARL
Download Length: 303 bp
>T229 NC_002696:c2719292-2718990 [Caulobacter vibrioides CB15]
TTGGGGGACGCCCGAAGAAAAGCCCGCGCCCGAGACGTGGCGCAAGTAGTCTGGACTTGGCGTGCGCTGGCCGATCTGAC
GGCTATCCGCGACTATATTGGCCAATTCAGCCCGCTCGCGGCCCAGCGCATGGCTTTACGGCTCAAGACCGCTGCTGACA
GCCTAGCGGAGTATCCCGAGCGCGGCCGCCTAGCAACAGCGACGCTCCGGGAGTTGGTCGTCGTTCCACCCTATGTGATC
CGCTATTATGTGGCTGACGGTCTGGTGCATATCGTCCGCATCCGGCACGCCGCCCGGTTGTGA
TTGGGGGACGCCCGAAGAAAAGCCCGCGCCCGAGACGTGGCGCAAGTAGTCTGGACTTGGCGTGCGCTGGCCGATCTGAC
GGCTATCCGCGACTATATTGGCCAATTCAGCCCGCTCGCGGCCCAGCGCATGGCTTTACGGCTCAAGACCGCTGCTGACA
GCCTAGCGGAGTATCCCGAGCGCGGCCGCCTAGCAACAGCGACGCTCCGGGAGTTGGTCGTCGTTCCACCCTATGTGATC
CGCTATTATGTGGCTGACGGTCTGGTGCATATCGTCCGCATCCGGCACGCCGCCCGGTTGTGA
Antitoxin
Download Length: 59 a.a. Molecular weight: 6363.99 Da Isoelectric Point: 3.7930
>AT229 WP_024265819.1 NC_002696:c2719420-2719244 [Caulobacter vibrioides CB15]
MVPEPSIFEIDAEAEEAADAEGMADIAAGRVVPHEEVSAWLDTWGTPEEKPAPETWRK
MVPEPSIFEIDAEAEEAADAEGMADIAAGRVVPHEEVSAWLDTWGTPEEKPAPETWRK
Download Length: 177 bp
>AT229 NC_002696:c2719420-2719244 [Caulobacter vibrioides CB15]
ATGGTCCCCGAGCCGTCCATCTTCGAGATTGACGCGGAAGCCGAAGAGGCCGCCGATGCGGAAGGCATGGCCGACATCGC
AGCCGGCCGCGTTGTACCCCACGAAGAGGTCTCCGCCTGGCTCGACACTTGGGGGACGCCCGAAGAAAAGCCCGCGCCCG
AGACGTGGCGCAAGTAG
ATGGTCCCCGAGCCGTCCATCTTCGAGATTGACGCGGAAGCCGAAGAGGCCGCCGATGCGGAAGGCATGGCCGACATCGC
AGCCGGCCGCGTTGTACCCCACGAAGAGGTCTCCGCCTGGCTCGACACTTGGGGGACGCCCGAAGAAAAGCCCGCGCCCG
AGACGTGGCGCAAGTAG
Similar Proteins
Only experimentally validated proteins are listed.
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T1008 | Escherichia coli O157:H7 str. Sakai | 37.5 | 95.652 | 0.359 |
T10119 | Escherichia coli | 36.364 | 95.652 | 0.348 |
T10143 | Pseudomonas savastanoi | 36.047 | 93.478 | 0.337 |
T1006 | Escherichia coli O157:H7 str. Sakai | 36.364 | 92.632 | 0.337 |
T226 | Caulobacter crescentus CB15 | 37.5 | 86.022 | 0.323 |
T178 | Vibrio cholerae O1 biovar El Tor str. N16961 | 34.066 | 91 | 0.31 |
T6097 | Sinorhizobium meliloti 1021 | 34.483 | 89.691 | 0.309 |
T10139 | Pseudomonas savastanoi | 34.568 | 89.011 | 0.308 |
Showing 1 to 8 of 8 rows
Multiple sequence alignment
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
No matching records found |
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3CA69 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3CAY6 |
References
(1) Aretha Fiebig et al. (2010) Interaction specificity, toxicity and regulation of a paralogous set of ParE/RelE-family toxin-antitoxin systems. Molecular Microbiology 77(1):236-51. [PubMed:20487277]