Detailed information of regulator


Summary

Regulator ID REG0142 experimental
Regulator type protein
Regulatory pathway (from literatures) bspR-dependent signalling cascade
KEGG pathway (determined by BlastKOALA) -
Related T6SS -
Strain Burkholderia pseudomallei strain KHW
Replicon chromosome
Sequence Protein sequence (211 a.a.); Nucleotide sequence (633 bp)
Description Deletion of reduced the expression of T6SS5 genes to less than 8% of wildÔÇÉtype level.
Reference

External database links

Locus tag (Gene) bspR
Coordinates (Strand) 258..890 (+)
NCBI ID 298239780
GenBank HM358865
Uniprot ID D7SD96_BURPE
KEGG ID but:X994_1612
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
tssA expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TetR_C_29 PF17938.3 7.8e-41 85..201
TetR_N PF00440.25 1.2e-12 17..63

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-210 MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETNERMLYYYFGSKEQLFTAVLEYAFSALMEAERAIDLEGVAPVEAITRLAHFVWDYYRDHPDLLRLLNNENLHEARYLQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRFYVTLSGLGYYMVSNRFTLAAIFGRDFSAQHERAEMVKMNTELLLAFLLRR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8719 - -



  Protein sequence of regulator: 211 a.a.    .

>REG0142 HM358865:258-890 [Burkholderia pseudomallei]
MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETNERMLYYYFGSKEQLFTAVLEYAFSALMEAERAIDL
EGVAPVEAITRLAHFVWDYYRDHPDLLRLLNNENLHEARYLQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRF
YVTLSGLGYYMVSNRFTLAAIFGRDFSAQHERAEMVKMNTELLLAFLLRR*

  Nucleotide sequence of regulator: 633 bp    .

>REG0142 HM358865:258-890 [Burkholderia pseudomallei]
ATGAATCAGCCAAAAATCAAAAGAGACCCAGAGGGAACCCGGCGCCGGATTCTGCTCGCGGCGGCCGAAGAGTTCGCGAC
AGGGGGGCTGTTCGGTGCGCGAGTCGACCAGATCGCGCGCCGCGCCGAGACCAACGAGCGGATGCTCTATTACTACTTCG
GCAGCAAGGAGCAATTGTTTACCGCGGTGCTCGAATACGCGTTTTCCGCGCTGATGGAGGCCGAGCGGGCGATCGATCTC
GAAGGCGTCGCGCCCGTCGAGGCGATCACGCGGCTCGCGCATTTCGTGTGGGACTACTATCGCGATCATCCCGATTTGCT
GCGCCTGCTCAACAACGAGAATCTGCACGAGGCGCGCTATTTGCAGAAATCGACGCGCATCCGCGAGATGATCTCGCCGA
TCGTCAAGACGCTCGACGGCGTGCTCGAGCGCGGCCAGAAGGCGGGGCTCTTTCGCACGGACATCGATTCGCTGCGGTTC
TACGTGACGCTGTCGGGGCTCGGCTACTACATGGTGTCGAACCGCTTCACGCTCGCCGCGATCTTCGGCCGCGATTTCAG
CGCGCAGCACGAGCGCGCCGAGATGGTCAAGATGAACACCGAGTTGCTGCTCGCGTTTCTGTTGAGGCGCTGA