Detailed information of regulator


Summary

Regulator ID REG0091 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (214 a.a.); Nucleotide sequence (642 bp)
Description Genes within a cluster (PFL_6078-6094) homologous to the P. aeruginosa HIS-I type VI secretion system were underexpressed in the gacA mutant at both early and late growth phase sampling points.
Reference

External database links

Locus tag (Gene) PFL_RS17995 (gacA/uvrY/SirA)
Coordinates (Strand) 4110513..4111154 (-)
NCBI ID 499374263
RefSeq NC_004129
Uniprot ID A0A2C9ENX2_PSEPH, A0A2W0FC96_9PSED, Q4KAR8_PSEF5, O69157_PSEFL, A0A2T6GGJ5_9PSED, A0A1H4MPQ8_9PSED
KEGG ID pfl:PFL_3563, pprc:PFLCHA0_c36050
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcripts -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.4e-27 4..116
GerE PF00196.21 1.1e-12 148..203

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-213 MIRVLVVDDHDLVRTGITRMLADIDGLQVVGQAESGEESLLKARELKPDVVLMDVKMPGIGGLEATRKLLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYLTKGAGLNEMVQAIRLVFAGQRYISPQIAQQLVFKSFQPSSDSPFDALSEREIQIALMIVGCQKVQIISDKLCLSPKTVNTYRYRIFEKLSISSDVELTLLAVRHGMVDASL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9961 - -



  Protein sequence of regulator: 214 a.a.    .

>REG0091 NC_004129:c4111154-4110513 [Pseudomonas protegens Pf-5]
MIRVLVVDDHDLVRTGITRMLADIDGLQVVGQAESGEESLLKARELKPDVVLMDVKMPGIGGLEATRKLLRSHPDIKVVA
VTVCEEDPFPTRLLQAGAAGYLTKGAGLNEMVQAIRLVFAGQRYISPQIAQQLVFKSFQPSSDSPFDALSEREIQIALMI
VGCQKVQIISDKLCLSPKTVNTYRYRIFEKLSISSDVELTLLAVRHGMVDASL*

  Nucleotide sequence of regulator: 642 bp    .

>REG0091 NC_004129:c4111154-4110513 [Pseudomonas protegens Pf-5]
TTGATAAGGGTGCTAGTAGTCGATGACCATGATCTCGTTCGTACGGGCATTACACGAATGTTGGCTGACATCGATGGCCT
GCAAGTAGTCGGGCAGGCGGAGTCAGGGGAAGAATCCCTGCTCAAGGCGCGGGAGCTGAAGCCCGATGTGGTCCTGATGG
ACGTCAAGATGCCAGGCATCGGCGGCCTCGAAGCCACGCGCAAACTGCTGCGCAGTCATCCGGACATCAAGGTCGTGGCG
GTCACCGTCTGCGAGGAAGATCCCTTTCCTACCCGCTTGCTGCAAGCGGGTGCGGCGGGCTATCTGACCAAGGGCGCCGG
TCTGAACGAAATGGTCCAGGCCATCCGCCTGGTATTTGCCGGCCAGCGCTATATCAGCCCGCAGATCGCTCAGCAATTGG
TGTTCAAGTCATTCCAGCCTTCCAGTGATTCACCGTTCGACGCCCTGTCGGAACGGGAGATCCAGATTGCGCTGATGATT
GTCGGCTGCCAGAAGGTGCAGATCATCTCCGACAAGCTGTGCCTGTCGCCGAAAACCGTGAATACCTACCGCTATCGCAT
TTTCGAGAAGCTCTCGATCAGCAGCGATGTCGAGTTGACGCTATTGGCGGTTCGTCACGGCATGGTTGATGCCAGCCTCT
GA