Detailed information of Recipient susceptibility factor


Summary

ID RSF000045 experimental
Strain Escherichia coli strain C600
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Response to T6SS attack protective
Known or putative function serine protease inhibitor
Description Survival of the Δeco mutant could be largely restored upon introduction of a plasmid encoding the wild-type eco+ gene, and the Δeco mutant could be rescued by the exogenously added serine protease inhibitor Pefabloc
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) DK885_RS08170 (eco)
Coordinates (Strand) 1618127..1618615 (-)
NCBI ID 446771953
RefSeq NZ_CP031214
Uniprot ID ECOT_ECODH, E3PDR1_ECOH1, ECOT_ECOHS, A0A0E1SZS0_ECOLX, A0A140N645_ECOBD, ECOT_ECOLC, A0A037Y6Z4_ECOLX, ECOT_ECO8A, ECOT_ECOBW, A0A0E1LZA0_ECOLX, ECOT_ECOLI, I2WMY3_ECOLX
KEGG ID ecd:ECDH10B_2366, ebd:ECBD_1450, elh:ETEC_2343, ecj:JW2197, ecx:EcHS_A2347, ebw:BWG_1983, eco:b2209, ecr:ECIAI1_2293, ecl:EcolC_1441
PDB ID 1ECY, 1XXD, 1EZU, 1SLX, 1ID5, 1IFG, 1P0S, 7CBK, 1XXF, 1AZZ, 1FI8, 4IW4, 1ECZ, 1EZS, 1SLW, 1XX9, 4NIY, 1SLV, 1SLU, 1N8O

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ecotin PF03974.15 2.6e-50 30..152

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9986 pos: 20-21. AWA-AE. MKTILPAVLFAAFATTSAWA



  Protein sequence: 163 a.a.    .

>RSF000045 NZ_CP031214:c1618615-1618127 [Escherichia coli]
MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLE
NKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAV
VR*

  Nucleotide sequence: 489 bp    .

>RSF000045 NZ_CP031214:c1618615-1618127 [Escherichia coli]
ATGAAGACCATTCTACCTGCAGTATTGTTTGCCGCTTTCGCTACCACTTCCGCCTGGGCGGCAGAAAGCGTCCAGCCACT
GGAAAAAATCGCGCCTTATCCACAAGCTGAAAAAGGGATGAAGCGTCAGGTGATTCAGTTAACCCCGCAAGAAGATGAAT
CTACCCTGAAAGTAGAACTGTTAATCGGTCAGACGCTGGAAGTCGATTGCAATTTGCATCGTCTCGGCGGGAAGCTGGAA
AACAAAACGCTGGAAGGCTGGGGCTATGATTATTATGTCTTTGATAAAGTCAGTTCCCCGGTTTCAACGATGATGGCCTG
CCCGGATGGCAAGAAAGAGAAGAAATTTGTCACCGCGTATCTGGGCGATGCTGGAATGCTGCGTTACAACAGCAAGCTGC
CGATCGTGGTGTATACGCCAGACAATGTAGATGTGAAGTACCGCGTCTGGAAGGCGGAAGAGAAAATTGACAACGCGGTA
GTTCGCTAA