Detailed information of Recipient susceptibility factor


Summary

ID RSF000043 experimental
Strain Escherichia coli str. K-12 substr. MC4100 strain K-12
Replicon chromosome
Sequence Protein sequence (363 a.a.); Nucleotide sequence (1089 bp)
Response to T6SS attack protective
Known or putative function outer membrane stability
Description The ΔompCΔompF double mutant strain and the ΔompT derivative stood out as particularly sensitive to the killing by V. cholerae.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BN896_RS04350 (ompF)
Coordinates (Strand) 888085..889173 (-)
NCBI ID 446900664
RefSeq NZ_HG738867
Uniprot ID A0A0E0Y309_ECO1C, K4WYC7_ECOLX, U9XEN3_ECOLX, E3PIV0_ECOH1, A7ZK20_ECO24, A0A140NAN5_ECOBD, E0IZB3_ECOLW, B7LE29_ECO55, A0A1X3JJZ0_ECOLX, A0A1X3L4S5_ECOLX, F4VCV3_ECOLX, E1IQ54_ECOLX, D8EAJ3_ECOLX, A0A0E1LVK6_ECOLX, E9TEP5_ECOLX, I4SAG3_ECOLX, OMPF_ECOLI, I2WW12_ECOLX
KEGG ID eco:b0929, eck:EC55989_0978, elw:ECW_m1039, esl:O3K_16695, ecw:EcE24377A_1029, ebd:ECBD_2666, elh:ETEC_0997, ecj:JW0912
PDB ID 1BT9, 1GFM, 1GFN, 1GFO, 1GFP, 1GFQ, 1HXT, 1HXU, 1HXX, 1MPF, 1OPF, 2OMF, 2ZFG, 2ZLD, 3FYX, 3HW9, 3HWB, 3K19, 3K1B, 3O0E, 3POQ, 3POU, 3POX, 4D5U, 4GCP, 4GCQ, 4GCS, 4JFB, 4LSE, 4LSF, 4LSH, 4LSI, 5NUO, 5NUQ, 5NUR, 6WTZ, 6ZHP, 6ZHV, 7NST, 7NSU

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Porin_1 PF00267.23 1.9e-139 28..362

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-362 MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9989 pos: 22-23. ANA-AE. MMKRNILAVIVPALLVAGTANA



  Protein sequence: 363 a.a.    .

>RSF000043 NZ_HG738867:c889173-888085 [Escherichia coli str. K-12 substr. MC4100]
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGY
GQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVAT
YRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVG
ATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF*

  Nucleotide sequence: 1089 bp    .

>RSF000043 NZ_HG738867:c889173-888085 [Escherichia coli str. K-12 substr. MC4100]
ATGATGAAGCGCAATATTCTGGCAGTGATCGTCCCTGCTCTGTTAGTAGCAGGTACTGCAAACGCTGCAGAAATCTATAA
CAAAGATGGCAACAAAGTAGATCTGTACGGTAAAGCTGTTGGTCTGCATTATTTTTCCAAGGGTAACGGTGAAAACAGTT
ACGGTGGCAATGGCGACATGACCTATGCCCGTCTTGGTTTTAAAGGGGAAACTCAAATCAATTCCGATCTGACCGGTTAT
GGTCAGTGGGAATATAACTTCCAGGGTAACAACTCTGAAGGCGCTGACGCTCAAACTGGTAACAAAACGCGTCTGGCATT
CGCGGGTCTTAAATACGCTGACGTTGGTTCTTTCGATTACGGCCGTAACTACGGTGTGGTTTATGATGCACTGGGTTACA
CCGATATGCTGCCAGAATTTGGTGGTGATACTGCATACAGCGATGACTTCTTCGTTGGTCGTGTTGGCGGCGTTGCTACC
TATCGTAACTCCAACTTCTTTGGTCTGGTTGATGGCCTGAACTTCGCTGTTCAGTACCTGGGTAAAAACGAGCGTGACAC
TGCACGCCGTTCTAACGGCGACGGTGTTGGCGGTTCTATCAGCTACGAATACGAAGGCTTTGGTATCGTTGGTGCTTATG
GTGCAGCTGACCGTACCAACCTGCAAGAAGCTCAACCTCTTGGCAACGGTAAAAAAGCTGAACAGTGGGCTACTGGTCTG
AAGTACGACGCGAACAACATCTACCTGGCAGCGAACTACGGTGAAACCCGTAACGCTACGCCGATCACTAATAAATTTAC
AAACACCAGCGGCTTCGCCAACAAAACGCAAGACGTTCTGTTAGTTGCGCAATACCAGTTCGATTTCGGTCTGCGTCCGT
CCATCGCTTACACCAAATCTAAAGCGAAAGACGTAGAAGGTATCGGTGATGTTGATCTGGTGAACTACTTTGAAGTGGGC
GCAACCTACTACTTCAACAAAAACATGTCCACCTATGTTGACTACATCATCAACCAGATCGATTCTGACAACAAACTGGG
CGTAGGTTCAGACGACACCGTTGCTGTGGGTATCGTTTACCAGTTCTAA