Detailed information of Recipient susceptibility factor


Summary

ID RSF000041 experimental
Strain Escherichia coli strain C600
Replicon chromosome
Sequence Protein sequence (347 a.a.); Nucleotide sequence (1041 bp)
Response to T6SS attack protective
Known or putative function outer membrane stability
Description The ompA mutant derivative of E. coli C600 was significantly more susceptible to killing by V. cholerae.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) DK885_RS15130 (OmpA)
Coordinates (Strand) 2901443..2902483 (+)
NCBI ID 446673070
RefSeq NZ_CP031214
Uniprot ID A0A0E0Y2P4_ECO1C, K4X0V9_ECOLX, S1F2T4_ECOLX, A0A0E1T320_ECOLX, A0A140NDE3_ECOBD, C3TFP7_ECOLX, A0A0H3EUH9_ECOLW, B7LE57_ECO55, Q6W821_SHISO, A0A0E1LVJ2_ECOLX, OMPA_ECOLI, OMPA_ECO57
KEGG ID eck:EC55989_1006, ecj:JW0940, elw:ECW_m1067, eco:b0957, ecs:ECs1041, esl:O3K_16555, ece:Z1307, ebd:ECBD_2638
PDB ID 1G90, 5M2Q, 6LYR, 2GE4, 6ITC, 2JMM, 3JBU, 1BXW, 2MQE, 1QJP

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
OmpA_membrane PF01389.19 1.7e-75 23..195
OmpA PF00691.22 1.5e-23 222..317

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-346 MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9993 pos: 21-22. AQA-AP. MKKTAIAIAVALAGFATVAQA



  Protein sequence: 347 a.a.    .

>RSF000041 NZ_CP031214:2901443-2902483 [Escherichia coli]
MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLG
RMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRL
EYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQ
LYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAAL
IDCLAPDRRVEIEVKGIKDVVTQPQA*

  Nucleotide sequence: 1041 bp    .

>RSF000041 NZ_CP031214:2901443-2902483 [Escherichia coli]
ATGAAAAAGACAGCTATCGCGATTGCAGTGGCACTGGCTGGTTTCGCTACCGTAGCGCAGGCCGCTCCGAAAGATAACAC
CTGGTACACTGGTGCTAAACTGGGCTGGTCCCAGTACCATGACACTGGTTTCATCAACAACAATGGCCCGACCCATGAAA
ACCAACTGGGCGCTGGTGCTTTTGGTGGTTACCAGGTTAACCCGTATGTTGGCTTTGAAATGGGTTACGACTGGTTAGGT
CGTATGCCGTACAAAGGCAGCGTTGAAAACGGTGCATACAAAGCTCAGGGCGTTCAACTGACCGCTAAACTGGGTTACCC
AATCACTGACGACCTGGACATCTACACTCGTCTGGGTGGCATGGTATGGCGTGCAGACACTAAATCCAACGTTTATGGTA
AAAACCACGACACCGGCGTTTCTCCGGTCTTCGCTGGCGGTGTTGAGTACGCGATCACTCCTGAAATCGCTACCCGTCTG
GAATACCAGTGGACCAACAACATCGGTGACGCACACACCATCGGCACTCGTCCGGACAACGGCATGCTGAGCCTGGGTGT
TTCCTACCGTTTCGGTCAGGGCGAAGCAGCTCCAGTAGTTGCTCCGGCTCCAGCTCCGGCACCGGAAGTACAGACCAAGC
ACTTCACTCTGAAGTCTGACGTTCTGTTCAACTTCAACAAAGCAACCCTGAAACCGGAAGGTCAGGCTGCTCTGGATCAG
CTGTACAGCCAGCTGAGCAACCTGGATCCGAAAGACGGTTCCGTAGTTGTTCTGGGTTACACCGACCGCATCGGTTCTGA
CGCTTACAACCAGGGTCTGTCCGAGCGCCGTGCTCAGTCTGTTGTTGATTACCTGATCTCCAAAGGTATCCCGGCAGACA
AGATCTCCGCACGTGGTATGGGCGAATCCAACCCGGTTACTGGCAACACCTGTGACAACGTGAAACAGCGTGCTGCACTG
ATCGACTGCCTGGCTCCGGATCGTCGCGTAGAGATCGAAGTTAAAGGTATCAAAGACGTTGTAACTCAGCCGCAGGCTTA
A