Detailed information of Recipient susceptibility factor


Summary

ID RSF000040 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (307 a.a.); Nucleotide sequence (921 bp)
Response to T6SS attack sensitive
Known or putative function Curved DNA-binding protein
Description Five mutants, clpP, gltA, ydhS, ydaE, and cbpA showed lower susceptibility to A. tumefaciens T6SS attack than that of BW25113 wild type.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS05200 (cbpA)
Coordinates (Strand) 1058311..1059231 (-)
NCBI ID 446342766
RefSeq NZ_CP009273
Uniprot ID S1EQV6_ECOLX, U9XY48_ECOLX, V0ADN1_ECOLX, A0A080J9I7_ECOLX, A0A0A0F8G0_ECOLX, CBPA_ECODH, E3PJG9_ECOH1, CBPA_ECOHS, A0A0E1T2S1_ECOLX, A0A140NB18_ECOBD, CBPA_ECOLC, D6I8R6_ECOLX, CBPA_ECOBW, A0A1X3JKV2_ECOLX, A0A1X3KRE1_ECOLX, F4TCN2_ECOLX, A0A1X3J3Y1_ECOLX, E9XMW3_ECOLX, A0A0E1LXG8_ECOLX, CBPA_ECOLI
KEGG ID ecx:EcHS_A1112, ebw:BWG_0854, elh:ETEC_1069, ecd:ECDH10B_1072, eco:b1000, ecl:EcolC_2595, ebd:ECBD_2594, ecj:JW0985
PDB ID 2KQX, 3UCS

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DnaJ_C PF01556.20 1.5e-34 120..276
DnaJ PF00226.33 2.1e-23 5..66

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-306 MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRNDPQFNRQFHHGDGQSFNAEDFDDIFSSIFGQHARQSRQRPATRGHDIEIEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTLNVKIPAGVGNGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLTIPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPRKDWGKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9911 - -



  Protein sequence: 307 a.a.    .

>RSF000040 NZ_CP009273:c1059231-1058311 [Escherichia coli BW25113]
MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRNDPQFNRQ
FHHGDGQSFNAEDFDDIFSSIFGQHARQSRQRPATRGHDIEIEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTL
NVKIPAGVGNGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLT
IPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPRKDWGKA*

  Nucleotide sequence: 921 bp    .

>RSF000040 NZ_CP009273:c1059231-1058311 [Escherichia coli BW25113]
ATGGAATTAAAGGATTATTACGCCATCATGGGCGTGAAACCGACGGACGATCTCAAGACAATCAAGACCGCCTATCGTCG
ACTTGCCCGCAAATACCATCCTGATGTCAGCAAAGAACCGGATGCCGAAGCCCGCTTCAAAGAGGTCGCTGAAGCCTGGG
AAGTGTTAAGTGATGAACAACGTCGCGCTGAGTATGATCAGATGTGGCAACATCGCAACGATCCGCAATTTAACCGTCAG
TTCCACCATGGCGACGGTCAGAGTTTTAACGCCGAAGATTTTGACGATATCTTCTCGTCAATTTTCGGTCAGCATGCCCG
CCAGAGCCGTCAACGCCCCGCCACACGCGGCCACGATATTGAAATCGAAGTGGCGGTATTCCTCGAAGAAACGCTTACTG
AGCATAAGCGTACCATCAGCTATAACCTGCCGGTTTATAACGCCTTTGGCATGATCGAACAGGAAATTCCGAAAACGCTG
AATGTGAAGATCCCGGCGGGCGTCGGCAATGGTCAACGCATCCGTCTGAAAGGCCAGGGGACGCCGGGCGAAAACGGCGG
TCCAAATGGCGATTTGTGGCTGGTGATTCATATTGCGCCACATCCGCTGTTTGATATTGTCGGCCAGGATCTGGAAATTG
TGGTGCCGGTTAGCCCGTGGGAAGCGGCGCTGGGTGCTAAAGTCACCGTTCCAACACTGAAAGAAAGCATTTTGCTGACT
ATCCCGCCAGGCAGCCAGGCCGGGCAACGATTGCGCGTTAAAGGCAAAGGTCTGGTGAGCAAAAAACAGACCGGCGATCT
GTATGCGGTACTGAAAATCGTGATGCCGCCGAAACCGGATGAAAACACTGCCGCGCTGTGGCAGCAACTGGCAGACGCCC
AGTCGTCTTTTGATCCACGTAAAGATTGGGGGAAAGCATAA