Detailed information of Recipient susceptibility factor


Summary

ID RSF000039 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (57 a.a.); Nucleotide sequence (171 bp)
Response to T6SS attack sensitive
Known or putative function Rac prophage; zinc-binding protein
Description Five mutants, clpP, gltA, ydhS, ydaE, and cbpA showed lower susceptibility to A. tumefaciens T6SS attack than that of BW25113 wild type.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS07100 (ydaE)
Coordinates (Strand) 1412095..1412265 (-)
NCBI ID 485720780
RefSeq NZ_CP009273
Uniprot ID K4WR59_ECOLX, A0A140NAA2_ECOBD, A0A0J2EMA1_ECOLX, YDAE_ECOLI
KEGG ID ecj:JW1346, eco:b4526, ebd:ECBD_2265
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RPAP2_Rtr1 PF04181.15 1.9e-05 6..52

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-56 MTKKIKCAYHLCKKDVEESKAIERMLHFMHGILSKDEPRKYCSEACAEKDQMAHEL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9664 - -



  Protein sequence: 57 a.a.    .

>RSF000039 NZ_CP009273:c1412265-1412095 [Escherichia coli BW25113]
MTKKIKCAYHLCKKDVEESKAIERMLHFMHGILSKDEPRKYCSEACAEKDQMAHEL*

  Nucleotide sequence: 171 bp    .

>RSF000039 NZ_CP009273:c1412265-1412095 [Escherichia coli BW25113]
ATGACTAAGAAAATAAAATGTGCTTACCACCTTTGCAAAAAAGACGTTGAAGAAAGCAAAGCTATTGAAAGAATGCTTCA
CTTCATGCACGGGATTTTATCAAAAGACGAACCGAGAAAATATTGCAGTGAAGCTTGTGCCGAAAAAGACCAGATGGCAC
ATGAACTTTAA