Detailed information of Recipient susceptibility factor


Summary

ID RSF000038 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (535 a.a.); Nucleotide sequence (1605 bp)
Response to T6SS attack sensitive
Known or putative function FAD/NAD(P) binding domain-containing protein
Description Five mutants, clpP, gltA, ydhS, ydaE, and cbpA showed lower susceptibility to A. tumefaciens T6SS attack than that of BW25113 wild type.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS08730 (ydhS)
Coordinates (Strand) 1741388..1742992 (+)
NCBI ID 446639604
RefSeq NZ_CP009273
Uniprot ID E3PMP3_ECOH1, A0A140NBE0_ECOBD, A0A024L2A7_ECOLX, A0A1X3JFX4_ECOLX, A0A0E1M2A7_ECOLX, YDHS_ECOLI
KEGG ID ebd:ECBD_1977, eco:b1668, elh:ETEC_1701, ecj:JW1658
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
NAD_binding_9 PF13454.8 1.7e-31 5..164

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-534 MKKIAIVGAGPTGIYTLFSLLQQQTPLSISIFEQADEAGVGMPYSDEENSKMMLANIASIEIPPIYCTYLEWLQKQEDSHLQRYGVKKETLHDRQFLPRILLGEYFRDQFLRLVDQARQQKFAVAVYESCQVTDLQITNAGVMLATNQDLPSETFDLAVIATGHVWPDEEEATRTYFPSPWSGLMEAKVDACNVGIMGTSLSGLDAAMAVAIQHGSFIEDDKQHVVFHRDNASEKLNITLLSRTGILPEADFYCPIPYEPLHIVTDQALNAEIQKGEEGLLDRVFRLIVEEIKFADPDWSQRIALESLNVDSFAQAWFAERKQRDPFDWAEKNLQEVERNKREKHTVPWRYVILRLHEAVQEIVPHLNEHDHKRFSKGLARVFIDNYAAIPSESIRRLLALREAGIIHILALGEDYKMEINESRTVLKTEDNSYSFDVFIDARGQRPLKVKDIPFPGLREQLQKTGDEIPDVGEDYTLQQPEDIRGRVAFGALPWLMHDQPFVQGLTACAEIGEAMARAVVKPASRARRRLSFD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7946 - -



  Protein sequence: 535 a.a.    .

>RSF000038 NZ_CP009273:1741388-1742992 [Escherichia coli BW25113]
MKKIAIVGAGPTGIYTLFSLLQQQTPLSISIFEQADEAGVGMPYSDEENSKMMLANIASIEIPPIYCTYLEWLQKQEDSH
LQRYGVKKETLHDRQFLPRILLGEYFRDQFLRLVDQARQQKFAVAVYESCQVTDLQITNAGVMLATNQDLPSETFDLAVI
ATGHVWPDEEEATRTYFPSPWSGLMEAKVDACNVGIMGTSLSGLDAAMAVAIQHGSFIEDDKQHVVFHRDNASEKLNITL
LSRTGILPEADFYCPIPYEPLHIVTDQALNAEIQKGEEGLLDRVFRLIVEEIKFADPDWSQRIALESLNVDSFAQAWFAE
RKQRDPFDWAEKNLQEVERNKREKHTVPWRYVILRLHEAVQEIVPHLNEHDHKRFSKGLARVFIDNYAAIPSESIRRLLA
LREAGIIHILALGEDYKMEINESRTVLKTEDNSYSFDVFIDARGQRPLKVKDIPFPGLREQLQKTGDEIPDVGEDYTLQQ
PEDIRGRVAFGALPWLMHDQPFVQGLTACAEIGEAMARAVVKPASRARRRLSFD*

  Nucleotide sequence: 1605 bp    .

>RSF000038 NZ_CP009273:1741388-1742992 [Escherichia coli BW25113]
ATGAAAAAAATTGCTATTGTGGGTGCCGGGCCTACGGGGATCTACACCTTATTCTCGCTTCTACAGCAACAAACTCCACT
TTCTATTTCTATCTTCGAGCAGGCTGACGAGGCCGGTGTCGGGATGCCATACAGTGATGAGGAAAACTCAAAAATGATGC
TGGCAAATATTGCCAGTATTGAAATACCGCCGATTTATTGTACGTATCTCGAATGGCTACAAAAGCAAGAAGACAGCCAT
CTCCAGCGTTATGGCGTTAAAAAAGAAACCTTGCACGATCGTCAGTTTTTACCGCGAATTCTGCTGGGCGAATATTTCCG
CGATCAATTTTTACGACTAGTAGACCAGGCACGACAGCAAAAATTTGCAGTGGCTGTTTATGAATCATGCCAGGTTACCG
ATCTGCAAATTACAAATGCTGGCGTCATGCTCGCTACAAATCAGGATTTACCCAGCGAGACGTTTGATTTAGCGGTGATC
GCCACGGGTCACGTCTGGCCTGATGAAGAAGAAGCAACCCGAACGTATTTTCCCAGCCCGTGGTCAGGCCTGATGGAAGC
AAAGGTCGATGCGTGTAACGTGGGTATTATGGGAACATCCTTGAGCGGACTGGATGCGGCAATGGCAGTGGCTATTCAGC
ATGGTTCGTTCATTGAAGATGATAAACAACACGTCGTTTTTCACCGCGATAACGCAAGTGAAAAGCTAAATATCACGTTG
TTGTCGCGCACGGGTATTTTACCCGAAGCCGATTTCTATTGCCCTATTCCCTACGAGCCCTTACACATCGTCACCGATCA
GGCATTAAATGCTGAGATTCAAAAAGGCGAAGAGGGCCTTTTGGATCGGGTATTTAGATTGATAGTAGAGGAAATCAAGT
TTGCTGATCCAGACTGGAGTCAACGCATAGCCTTAGAGAGCCTGAATGTCGATTCCTTTGCTCAAGCCTGGTTTGCCGAG
CGCAAACAACGCGACCCATTTGACTGGGCAGAAAAAAATCTCCAGGAAGTCGAACGCAATAAACGAGAAAAACATACTGT
TCCCTGGCGTTATGTCATTCTGCGCCTGCATGAAGCCGTACAGGAAATTGTTCCACATCTGAATGAACACGACCATAAAC
GGTTCAGTAAAGGCCTTGCCCGGGTTTTCATCGATAATTATGCGGCAATCCCTTCAGAGTCTATTCGTCGCCTACTTGCC
TTACGTGAAGCGGGAATCATTCATATTCTCGCCCTCGGTGAAGACTACAAAATGGAAATTAATGAGTCGCGCACCGTCCT
GAAAACGGAAGACAACAGCTACTCGTTTGACGTTTTTATTGATGCCCGCGGACAACGTCCGCTTAAAGTGAAAGATATCC
CTTTCCCTGGGCTACGCGAGCAATTACAGAAAACAGGGGATGAAATCCCTGATGTTGGCGAAGATTATACGTTACAGCAA
CCCGAAGATATTCGTGGGCGCGTAGCGTTCGGCGCGTTGCCCTGGTTGATGCACGACCAGCCTTTCGTTCAGGGACTTAC
GGCATGTGCAGAAATTGGTGAGGCGATGGCTCGGGCGGTCGTAAAGCCTGCATCCCGTGCTCGTCGGCGTCTTTCGTTTG
ATTAA