Detailed information of Recipient susceptibility factor


Summary

ID RSF000037 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (428 a.a.); Nucleotide sequence (1284 bp)
Response to T6SS attack sensitive
Known or putative function citrate synthase
Description Five mutants, clpP, gltA, ydhS, ydaE, and cbpA showed lower susceptibility to A. tumefaciens T6SS attack than that of BW25113 wild type.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS03725 (gltA)
Coordinates (Strand) 748641..749924 (-)
NCBI ID 446708488
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y3S5_ECO1C, K4VXY5_ECOLX, S1PL05_ECOLX, S1FE12_ECOLX, L3QDM6_ECOLX, L4JEI1_ECOLX, U9XQC4_ECOLX, V0SDD6_ECOLX, U9ZCN5_ECOLX, V0UHV0_ECOLX, V0Z491_ECOLX, V0AB93_ECOLX, A0A0E2LMQ8_ECOU3, A0A0A0FEB3_ECOLX, CISY_ECOL6, D3GY59_ECO44, E3PHA9_ECOH1, A7ZJA1_ECO24, A0A0E1SX14_ECOLX, Q1REK6_ECOUT, A0A0H2YX65_ECOK1, B1LLF4_ECOSM, A0A140NC10_ECOBD, D6J828_ECOLX, F4NPQ0_ECOLX, E2QI94_ECOLX, E0J6G8_ECOLW, B7ULJ7_ECO27, B7MFX6_ECO45, B7LAC6_ECO55, B7N9V9_ECOLU, A0A2S8E0K6_SHIDY, A0A0I1VBD5_SHISO, A0A1X3JK70_ECOLX, A0A1X3L3V4_ECOLX, A0A1X3I8K1_ECOLX, A0A0K9TCY5_ECOLX, F4SW41_ECOLX, A0A1X3LV11_ECOLX, A0A1X3J3W8_ECOLX, E9XNU9_ECOLX, E6BD63_ECOLX, E1IWS4_ECOLX, E1JA48_ECOLX, D8E8M2_ECOLX, A0A0H3EGB9_ECO8N, A0A0E1LZ68_ECOLX, D8A873_ECOMS, D7XV13_ECOLX, D7Y3M2_ECOM1, E9TB09_ECOLX, I4SLY5_ECOLX, CISY_ECOLI, I2UK93_ECOLX, I2WS37_ECOLX
KEGG ID ecg:E2348C_0600, ecz:ECS88_0745, elw:ECW_m0774, eum:ECUMN_0798, eci:UTI89_C0715, ecw:EcE24377A_0747, esl:O3K_18045, ecc:c0796, eck:EC55989_0703, ecv:APECO1_1358, elo:EC042_0737, ecm:EcSMS35_0732, elh:ETEC_0731, ebd:ECBD_2941, eln:NRG857_03205, eco:b0720, ecj:JW0710
PDB ID 4JAE, 4JAD, 1NXE, 1OWC, 4JAF, 1OWB, 4JAG, 1NXG, 4G6B

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Citrate_synt PF00285.23 3.5e-131 46..410

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-427 MADTKAKLTLNGDTAVELDVLKGTLGQDVIDIRTLGSKGVFTFDPGFTSTASCESKITFIDGDEGILLHRGFPIDQLATDSNYLEVCYILLNGEKPTQEQYDEFKTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILERAMDRILILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISSVKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVAMELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWSEMHSDGMKIARPRQLYTGYEKRDFKSDIKR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9940 - -



  Protein sequence: 428 a.a.    .

>RSF000037 NZ_CP009273:c749924-748641 [Escherichia coli BW25113]
MADTKAKLTLNGDTAVELDVLKGTLGQDVIDIRTLGSKGVFTFDPGFTSTASCESKITFIDGDEGILLHRGFPIDQLATD
SNYLEVCYILLNGEKPTQEQYDEFKTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREI
AAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILERAMDRILILHADHEQNASTSTVR
TAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISSVKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMR
ETCHEVLKELGTKDDLLEVAMELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWSEMH
SDGMKIARPRQLYTGYEKRDFKSDIKR*

  Nucleotide sequence: 1284 bp    .

>RSF000037 NZ_CP009273:c749924-748641 [Escherichia coli BW25113]
ATGGCTGATACAAAAGCAAAACTCACCCTCAACGGGGATACAGCTGTTGAACTGGATGTGCTGAAAGGCACGCTGGGTCA
AGATGTTATTGATATCCGTACTCTCGGTTCAAAAGGTGTGTTCACCTTTGACCCAGGCTTCACTTCAACCGCATCCTGCG
AATCTAAAATTACTTTTATTGATGGTGATGAAGGTATTTTGCTGCACCGCGGTTTCCCGATCGATCAGCTGGCGACCGAT
TCTAACTACCTGGAAGTTTGTTACATCCTGCTGAATGGTGAAAAACCGACTCAGGAACAGTATGACGAATTTAAAACTAC
GGTGACCCGTCATACCATGATCCACGAGCAGATTACCCGTCTGTTCCATGCTTTCCGTCGCGACTCGCATCCAATGGCAG
TCATGTGTGGTATTACCGGCGCGCTGGCGGCGTTCTATCACGACTCGCTGGATGTTAACAATCCTCGTCACCGTGAAATT
GCCGCGTTCCGCCTGCTGTCGAAAATGCCGACCATGGCCGCGATGTGTTACAAGTATTCCATTGGTCAGCCATTTGTTTA
CCCGCGCAACGATCTCTCCTACGCCGGTAACTTCCTGAATATGATGTTCTCCACGCCGTGCGAACCGTATGAAGTTAATC
CGATTCTGGAACGTGCTATGGACCGTATTCTGATCCTGCACGCTGACCATGAACAGAACGCCTCTACCTCCACCGTGCGT
ACCGCTGGCTCTTCGGGTGCGAACCCGTTTGCCTGTATCGCAGCAGGTATTGCTTCACTGTGGGGACCTGCGCACGGCGG
TGCTAACGAAGCGGCGCTGAAAATGCTGGAAGAAATCAGCTCCGTTAAACACATTCCGGAATTTGTTCGTCGTGCGAAAG
ACAAAAATGATTCTTTCCGCCTGATGGGCTTCGGTCACCGCGTGTACAAAAATTACGACCCGCGCGCCACCGTAATGCGT
GAAACCTGCCATGAAGTGCTGAAAGAGCTGGGCACGAAGGATGACCTGCTGGAAGTGGCTATGGAGCTGGAAAACATCGC
GCTGAACGACCCGTACTTTATCGAGAAGAAACTGTACCCGAACGTCGATTTCTACTCTGGTATCATCCTGAAAGCGATGG
GTATTCCGTCTTCCATGTTCACCGTCATTTTCGCAATGGCACGTACCGTTGGCTGGATCGCCCACTGGAGCGAAATGCAC
AGTGACGGTATGAAGATTGCCCGTCCGCGTCAGCTGTATACAGGATATGAAAAACGCGACTTTAAAAGCGATATCAAGCG
TTAA