Detailed information of Recipient susceptibility factor


Summary

ID RSF000036 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (759 a.a.); Nucleotide sequence (2277 bp)
Response to T6SS attack sensitive
Known or putative function serine protease adapter
Description The ClpP-Associated AAA+ ATPase ClpA but not ClpX is involved in enhancing susceptibility to Agrobacterium tumefaciens Type VI Secretion System activity
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS04580 (ClpA)
Coordinates (Strand) 918720..920996 (+)
NCBI ID 446856785
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y1T5_ECO1C, K4VWN2_ECOLX, L3QCL7_ECOLX, L4JEX4_ECOLX, U9Y2M4_ECOLX, U9XKC4_ECOLX, V0SM68_ECOLX, U9ZGU3_ECOLX, V0XW66_ECOLX, V0YSR0_ECOLX, A0A0E2L7M9_ECOU3, A0A080JA87_ECOLX, A0A0A0FDH7_ECOLX, CLPA_ECOL6, D3GZV3_ECO44, A7ZJV0_ECO24, B1LKM8_ECOSM, A0A0H3PT68_ECO5C, D6I821_ECOLX, A0A163V8E9_KLEOX, B7UMX4_ECO27, B7MHI8_ECO45, B7LD75_ECO55, B7NAN3_ECOLU, A0A0H3MRY3_ECO7I, B7MRT9_ECO81, A0A1S9JGX9_SHIBO, A0A2S8D5T0_SHIDY, A0A0I2UFU3_SHISO, A0A1X3LH86_ECOLX, A0A1X3LVN6_ECOLX, E6BCN9_ECOLX, E1IQT9_ECOLX, E1JAI3_ECOLX, D8EAE2_ECOLX, A0A0H3EGS4_ECO8N, A0A0E1LZP2_ECOLX, D8A2P5_ECOMS, D7XHW7_ECOLX, D7YAR3_ECOM1, E9TEU6_ECOLX, I4SA66_ECOLX, CLPA_ECOLI, CLPA_ECO57, I2UKL9_ECOLX, I2WLF5_ECOLX
KEGG ID eco:b0882, eln:NRG857_03995, ecm:EcSMS35_2278, ecw:EcE24377A_0955, ecc:c1019, ect:ECIAI39_2269, elo:EC042_0974, eum:ECUMN_1077, ece:Z1119, ecz:ECS88_0904, ecj:JW0866, eck:EC55989_0927, ecq:ECED1_0849, ecs:ECs0968, ecg:E2348C_0879, esl:O3K_16935
PDB ID 1LZW, 1MBX, 1R6Q, 6UQE, 6W24, 6W1Z, 1R6C, 1R6O, 1MG9, 1KSF, 1MBU, 5OFO, 6W23, 6W22, 1R6B, 5OG1, 6UQO, 6W21, 1K6K, 1MBV, 6W20

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 1.6e-47 486..647
AAA_lid_9 PF17871.3 5e-30 350..452
ClpB_D2-small PF10431.11 1.4e-24 653..733
Clp_N PF02861.22 7.6e-15 13..62
AAA PF00004.31 8.6e-13 211..342

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-758 MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEAFIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSEEQAGGEERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFGSLVDGGQVTVALDKEKNELTYGFQSAQKHKAEAAH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9210 - -



  Protein sequence: 759 a.a.    .

>RSF000036 NZ_CP009273:918720-920996 [Escherichia coli BW25113]
MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEAFIEQTTPVLPASEEERDTQP
TLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKDEPTQSSDPGSQPNSE
EQAGGEERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVM
ADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIG
STTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAID
VIDEAGARARLMPVSKRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAG
LGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAV
LLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEF
RNRLDNIIWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARVIQDNLKKPLANEL
LFGSLVDGGQVTVALDKEKNELTYGFQSAQKHKAEAAH*

  Nucleotide sequence: 2277 bp    .

>RSF000036 NZ_CP009273:918720-920996 [Escherichia coli BW25113]
ATGCTCAATCAAGAACTGGAACTCAGTTTAAATATGGCTTTCGCCAGAGCGCGCGAGCACCGTCATGAGTTTATGACCGT
CGAGCACTTGTTACTGGCGCTGCTCAGTAACCCATCTGCCCGGGAGGCGCTGGAAGCGTGTTCTGTGGATTTGGTTGCGC
TCCGTCAGGAACTGGAAGCCTTTATTGAACAAACCACACCCGTTCTGCCTGCCAGTGAAGAGGAGCGCGACACACAGCCG
ACGCTGAGTTTTCAGCGTGTACTGCAACGTGCGGTCTTCCATGTCCAGTCCTCCGGTCGCAATGAGGTTACCGGTGCAAA
CGTTCTGGTCGCTATCTTTAGCGAACAGGAGTCGCAGGCGGCATATCTGTTGCGTAAACATGAAGTCAGCCGTCTCGATG
TGGTGAACTTTATCTCTCATGGCACGCGTAAAGACGAGCCGACACAGTCTTCTGATCCTGGCAGCCAGCCAAACAGCGAA
GAACAAGCTGGTGGGGAGGAACGTATGGAGAATTTCACGACGAACCTGAATCAGCTTGCGCGCGTGGGCGGAATCGACCC
ACTGATTGGTCGTGAGAAGGAGCTGGAGCGTGCTATTCAGGTTCTCTGCCGTCGCCGTAAAAACAACCCGCTGCTGGTGG
GGGAATCTGGTGTCGGTAAAACCGCGATTGCGGAAGGTCTTGCCTGGCGAATTGTTCAGGGCGATGTGCCGGAAGTGATG
GCTGACTGTACGATTTACTCTCTCGATATCGGTTCTCTGTTAGCGGGCACAAAATATCGCGGCGACTTTGAAAAACGTTT
TAAAGCGTTGCTCAAGCAGCTGGAGCAGGACACTAACAGCATCCTGTTTATTGATGAGATCCACACCATTATCGGTGCGG
GTGCAGCGTCTGGTGGTCAGGTCGATGCGGCTAACCTAATCAAACCGTTGCTCTCCAGCGGTAAAATTCGTGTAATTGGT
TCGACAACCTATCAGGAGTTCAGCAACATTTTCGAGAAAGACCGTGCTCTGGCGCGTCGCTTCCAGAAAATTGATATTAC
TGAACCGTCGATCGAAGAAACTGTTCAAATCATCAATGGCCTGAAACCGAAGTATGAAGCGCACCACGACGTGCGTTATA
CCGCAAAAGCGGTGCGTGCGGCGGTAGAGCTGGCGGTGAAATACATTAACGATCGTCATCTGCCGGATAAAGCCATTGAT
GTTATCGACGAAGCGGGCGCTCGCGCACGCCTGATGCCGGTAAGCAAACGCAAGAAAACCGTTAATGTGGCGGATATTGA
GTCCGTGGTGGCCCGTATTGCACGCATTCCAGAGAAGAGTGTTTCTCAGAGTGATCGTGATACCCTGAAAAACCTCGGCG
ATCGCTTGAAAATGCTGGTCTTCGGTCAGGATAAAGCCATTGAGGCGCTGACTGAAGCCATTAAGATGGCGCGTGCAGGT
TTAGGTCACGAACATAAACCGGTTGGTTCGTTCCTGTTTGCCGGCCCTACCGGGGTCGGGAAAACAGAGGTGACGGTACA
GCTTTCGAAAGCTTTGGGCATTGAGCTTCTGCGCTTTGATATGTCCGAGTATATGGAACGCCATACCGTCAGCCGTCTTA
TTGGTGCGCCTCCGGGATACGTTGGTTTTGATCAGGGCGGTTTGCTGACTGATGCGGTCATCAAGCATCCACATGCGGTG
CTGCTGCTGGACGAAATCGAGAAAGCGCACCCGGACGTGTTCAATATTCTGTTGCAGGTGATGGATAACGGTACGCTGAC
CGATAACAACGGACGCAAAGCAGACTTCCGTAACGTGGTGCTGGTGATGACCACCAACGCCGGGGTACGGGAAACTGAGC
GCAAATCCATTGGTCTTATCCACCAGGATAACAGCACCGATGCGATGGAAGAGATCAAGAAGATCTTTACACCGGAATTC
CGTAACCGTCTCGACAACATTATCTGGTTTGATCATCTGTCAACCGACGTGATCCATCAGGTGGTGGATAAATTCATCGT
CGAGTTGCAGGTTCAGCTGGATCAGAAAGGTGTTTCTCTGGAAGTGAGCCAGGAAGCGCGTAACTGGCTGGCCGAGAAAG
GTTACGACCGGGCAATGGGCGCTCGTCCGATGGCGCGTGTCATCCAGGACAACCTGAAAAAACCGCTCGCCAACGAACTG
CTGTTTGGTTCGCTGGTGGACGGCGGTCAGGTCACCGTCGCGCTGGATAAAGAGAAAAATGAGCTGACTTACGGATTCCA
GAGTGCACAAAAGCACAAGGCGGAAGCAGCGCATTAA