Detailed information of Recipient susceptibility factor


Summary

ID RSF000035 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (208 a.a.); Nucleotide sequence (624 bp)
Response to T6SS attack sensitive
Known or putative function serine protease
Description Five mutants, clpP, gltA, ydhS, ydaE, and cbpA showed lower susceptibility to A. tumefaciens T6SS attack than that of BW25113 wild type.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS02265 (clpP)
Coordinates (Strand) 452133..452756 (+)
NCBI ID 446044398
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y6A5_ECO1C, K4Y0L2_ECOLX, S1PK16_ECOLX, S1EW18_ECOLX, L3QH23_ECOLX, L4JED2_ECOLX, V0AH82_ECOLX, A0A0E2L9M1_ECOU3, A0A080JG42_ECOLX, A0A0A0FC08_ECOLX, CLPP_ECOL6, D3GV67_ECO44, CLPP_SHIDS, E3PFQ3_ECOH1, CLPP_ECO24, CLPP_ECOHS, A0A0E1SUV7_ECOLX, CLPP_ECOL5, CLPP_ECOUT, CLPP_ECOK1, B1LJJ4_ECOSM, A0A140NEW8_ECOBD, A0A0H3PR91_ECO5C, CLPP_ECOLC, D6J7D7_ECOLX, A0A2S7SNY8_ESCFE, E0J0J9_ECOLW, A0A169QWL1_KLEOX, B7UJR0_ECO27, B7MD96_ECO45, B7LME2_ESCF3, B7L674_ECO55, B7N8Z1_ECOLU, A0A0H3MEA1_ECO7I, B7MQF3_ECO81, A0A1Q8MKU4_SHIBO, A0A1Q8NHH5_SHIDY, CLPP_SHIFL, A0A0I2X2B6_SHISO, A0A1X3JLI8_ECOLX, A0A1X3L7N0_ECOLX, F4VAM3_ECOLX, A0A1X3KPW7_ECOLX, A0A1X3IAW6_ECOLX, A0A0K9TA59_ECOLX, F4SU63_ECOLX, F4TAV2_ECOLX, A0A1X3LNB1_ECOLX, A0A1X3LUB4_ECOLX, A0A1X3J6K0_ECOLX, E9XPL3_ECOLX, E1IPF1_ECOLX, D8E114_ECOLX, A0A0H3EFS7_ECO8N, A0A0E1LU99_ECOLX, D7XK90_ECOLX, D7Y330_ECOM1, I4SYK4_ECOLX, CLPP_ECOLI, CLPP_ECO57, I2UQT2_ECOLX, I2WT21_ECOLX, A0A192CHZ0_ECOLX
KEGG ID elh:ETEC_0490, ecq:ECED1_0461, eci:UTI89_C0465, elo:EC042_0475, esl:O3K_19305, eum:ECUMN_0477, eln:NRG857_02065, ecw:EcE24377A_0473, efe:EFER_2580, ecg:E2348C_0372, sfx:S0388, ece:Z0542, ecp:ECP_0498, ecx:EcHS_A0514, ecl:EcolC_3195, ecc:c0553, ecj:JW0427, ect:ECIAI39_0236, eck:EC55989_0451, ecs:ECs0491, eco:b0437, elw:ECW_m0509, ebd:ECBD_3220, ecv:APECO1_1574, sdy:SDY_0295, sfl:SF0382, ecm:EcSMS35_0480, ecz:ECS88_0434
PDB ID 6NB1, 2FZS, 6PO3, 6UQE, 6WR2, 1YG8, 6W1Z, 6POD, 6WRF, 1YG6, 6WSG, 3MT6, 6PO1, 1TYF, 6POS, 6UQO, 6W21, 3HLN, 6PPE, 6W20

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
CLP_protease PF00574.25 1.7e-88 26..205

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-207 MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9949 - -



  Protein sequence: 208 a.a.    .

>RSF000035 NZ_CP009273:452133-452756 [Escherichia coli BW25113]
MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSP
GGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVK
GRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN*

  Nucleotide sequence: 624 bp    .

>RSF000035 NZ_CP009273:452133-452756 [Escherichia coli BW25113]
ATGTCATACAGCGGCGAACGAGATAACTTTGCACCCCATATGGCGCTGGTGCCGATGGTCATTGAACAGACCTCACGCGG
TGAGCGCTCTTTTGATATCTATTCTCGTCTACTTAAGGAACGCGTCATTTTTCTGACTGGCCAGGTTGAAGACCACATGG
CTAACCTGATTGTGGCGCAGATGCTGTTCCTGGAAGCGGAAAACCCAGAAAAAGATATCTATCTGTACATTAACTCCCCA
GGCGGGGTGATCACTGCCGGGATGTCTATCTATGACACCATGCAGTTTATCAAGCCTGATGTCAGCACCATCTGTATGGG
CCAGGCGGCCTCGATGGGCGCTTTCTTGCTGACCGCAGGGGCAAAAGGTAAACGTTTTTGCCTGCCGAATTCGCGCGTGA
TGATTCACCAACCGTTGGGCGGCTACCAGGGCCAGGCGACCGATATCGAAATTCATGCCCGTGAAATTCTGAAAGTTAAA
GGGCGCATGAATGAACTTATGGCGCTTCATACGGGTCAATCATTAGAACAGATTGAACGTGATACCGAGCGCGATCGCTT
CCTTTCCGCCCCTGAAGCGGTGGAATACGGTCTGGTCGATTCGATTCTGACCCATCGTAATTGA