Detailed information of Recipient susceptibility factor


Summary

ID RSF000032 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (162 a.a.); Nucleotide sequence (486 bp)
Response to T6SS attack protective
Known or putative function Maintaining envelope integrity
Description Overexpression of Spy protected the ΔdegP strain and other sensitive E. coli mutants against TseH
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS09120 (Spy)
Coordinates (Strand) 1819397..1819882 (-)
NCBI ID 447151728
RefSeq NZ_CP009273
Uniprot ID S1EX41_ECOLX, E3PNC7_ECOH1, A0A0E1SY60_ECOLX, W8SYE2_ECOLX, A0A1X3JGY7_ECOLX, A0A0E1M2L7_ECOLX, SPY_ECOLI
KEGG ID elh:ETEC_1775, ecj:JW1732, eco:b1743
PDB ID 6OWX, 6OWZ, 6OWY, 5WNW, 5WO2, 5WO3, 5WO1, 6BIE

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
LTXXQ PF07813.14 6.8e-24 46..141

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-161 MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9985 pos: 23-24. AHA-AD. MRKLTALFVASTLALGAANLAHA



  Protein sequence: 162 a.a.    .

>RSF000032 NZ_CP009273:c1819882-1819397 [Escherichia coli BW25113]
MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPP
LEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATA
E*

  Nucleotide sequence: 486 bp    .

>RSF000032 NZ_CP009273:c1819882-1819397 [Escherichia coli BW25113]
ATGCGTAAATTAACTGCACTGTTTGTTGCCTCTACCCTGGCTCTTGGCGCGGCTAACCTGGCCCATGCCGCAGACACCAC
TACCGCAGCACCGGCTGACGCGAAGCCGATGATGCACCACAAAGGCAAGTTCGGTCCGCATCAGGACATGATGTTCAAAG
ACCTGAACCTGACCGACGCGCAGAAACAGCAGATCCGCGAAATCATGAAAGGCCAGCGTGACCAGATGAAACGTCCGCCG
CTGGAAGAACGCCGCGCAATGCATGACATCATTGCCAGCGATACCTTCGATAAAGTAAAAGCTGAAGCGCAGATCGCAAA
AATGGAAGAACAGCGCAAAGCTAACATGCTGGCGCACATGGAAACCCAGAACAAAATTTACAACATCCTGACGCCGGAAC
AGAAAAAGCAATTTAATGCTAATTTTGAGAAGCGTCTGACAGAACGTCCAGCGGCAAAAGGTAAAATGCCTGCAACTGCT
GAATAA