Detailed information of Recipient susceptibility factor


Summary

ID RSF000030 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (208 a.a.); Nucleotide sequence (624 bp)
Response to T6SS attack protective
Known or putative function RcsB regulon response envelope stress
Description Overexpression of rcsA protected E. coli by up to 10,000-fold compared with the vector-only control against the T6SS of WT V. cholerae V52 with all four antibacterial effec- tors intact and active and the protection did not occur in the ΔwcaJ background.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS10200 (RcsA)
Coordinates (Strand) 2017449..2018072 (+)
NCBI ID 446026146
RefSeq NZ_CP009273
Uniprot ID K4WRU6_ECOLX, L4J9U1_ECOLX, U9YVJ7_ECOLX, U9Z1S1_ECOLX, V0ZA12_ECOLX, A0A0E2LIY6_ECOU3, E3PBD7_ECOH1, A0A0H2YZR7_ECOK1, C3T4Q7_ECOLX, A0A170UEY3_KLEOX, B7MCK7_ECO45, B7NBU4_ECOLU, A0A0K9T5N9_ECOLX, F4TFT6_ECOLX, A0A1X3LZG6_ECOLX, E9XIP6_ECOLX, D8E6L5_ECOLX, RCSA_ECOLI, RCSA_ECO57
KEGG ID eum:ECUMN_2243, ecv:APECO1_990, eco:b1951, ece:Z3041, ecz:ECS88_2004, elh:ETEC_2054, ecj:JW1935, ecs:ECs2690
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GerE PF00196.21 4.3e-19 137..191

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-207 MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9799 - -



  Protein sequence: 208 a.a.    .

>RSF000030 NZ_CP009273:2017449-2018072 [Escherichia coli BW25113]
MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLF
IVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISD
QMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR*

  Nucleotide sequence: 624 bp    .

>RSF000030 NZ_CP009273:2017449-2018072 [Escherichia coli BW25113]
ATGTCAACGATTATTATGGATTTATGTAGTTACACCCGACTAGGTTTAACCGGGTATCTGTTGAGTAGAGGGGTTAAAAA
AAGAGAAATCAACGACATTGAAACCGTTGATGACCTTGCCATAGCTTGTGATTCACAGCGCCCTTCAGTGGTGTTTATTA
ATGAGGACTGTTTCATCCACGATGCTTCTAACAGTCAGCGTATCAAGCTCATCATTAATCAACATCCCAATACGTTATTT
ATCGTTTTTATGGCAATTGCCAATGTTCATTTTGATGAATATCTATTGGTCAGAAAAAATTTATTGATCAGTTCTAAATC
GATTAAACCGGAATCTCTCGACGATATCCTTGGCGATATTCTGAAAAAAGAGACAACGATAACCTCGTTTTTAAATATGC
CGACGTTATCATTGAGCCGAACCGAATCGAGTATGTTGCGAATGTGGATGGCAGGTCAGGGAACCATTCAAATCTCTGAC
CAAATGAATATCAAAGCCAAGACCGTTTCATCGCATAAAGGTAATATTAAACGTAAGATCAAAACGCATAATAAACAGGT
TATCTACCATGTCGTCCGACTGACGGATAATGTGACTAATGGTATTTTTGTCAACATGCGCTAA