Detailed information of Recipient susceptibility factor


Summary

ID RSF000029 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (72 a.a.); Nucleotide sequence (216 bp)
Response to T6SS attack protective
Known or putative function -
Description osmB and bdm, which respond to osmotic stress, a potential consequence of peptidoglycan damage regulated by RcsB played a role in protecting against TseH-mediated killing, as the survival of the mutant strains was significantly reduced.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS07765 (bdm)
Coordinates (Strand) 1550322..1550537 (-)
NCBI ID 446417916
RefSeq NZ_CP009273
Uniprot ID S1F9K8_ECOLX, V0AC38_ECOLX, A0A0A0FG82_ECOLX, E3PLY1_ECOH1, A0A0E1STS5_ECOLX, A0A140NA01_ECOBD, A0A1X3JHG6_ECOLX, E6BQQ1_ECOLX, E1IT51_ECOLX, E1JCP7_ECOLX, A0A0E1M1P5_ECOLX, D7XVX3_ECOLX, D7Y0D4_ECOM1, BDM_ECOLI
KEGG ID eco:b1481, ebd:ECBD_2158, ecj:JW5239, elh:ETEC_1551
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
BDM PF10684.11 2.7e-52 1..71

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-71 MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9902 - -



  Protein sequence: 72 a.a.    .

>RSF000029 NZ_CP009273:c1550537-1550322 [Escherichia coli BW25113]
MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL*

  Nucleotide sequence: 216 bp    .

>RSF000029 NZ_CP009273:c1550537-1550322 [Escherichia coli BW25113]
ATGTTTACTTATTATCAGGCAGAAAATTCAACAGCAGAACCCGCTCTGGTTAATGCCATTGAGCAAGGCCTTCGGGCACA
GCATGGTGTTGTCACTGAAGATGACATTCTCATGGAGCTGACCAAATGGGTTGAAGCTTCTGATAACGACATCCTCAGTG
ATATCTACCAGCAAACGATCAATTATGTGGTCAGTGGCCAGCACCCTACGCTTTAA