Detailed information of Recipient susceptibility factor


Summary

ID RSF000028 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (380 a.a.); Nucleotide sequence (1140 bp)
Response to T6SS attack protective
Known or putative function colanic acid synthesis
Description Deletion of genes involved in colanic acid synthesis (wza and wcaA) regulated by Rcs reduced survival, suggesting that this Rcs-induced EPS protects E. coli against T6SS attacks.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS10765 (wza)
Coordinates (Strand) 2129585..2130724 (-)
NCBI ID 446900838
RefSeq NZ_CP009273
Uniprot ID A0A0E0XXF8_ECO1C, S1F5Z9_ECOLX, L3Q459_ECOLX, L4J5Q9_ECOLX, U9XZK9_ECOLX, U9XZ50_ECOLX, V0SLG2_ECOLX, U9ZSC2_ECOLX, V0VGH7_ECOLX, V0YGP8_ECOLX, V0YIK3_ECOLX, U9ZHH3_ECOLX, A0A0E2LJB6_ECOU3, D3GZC4_ECO44, A7ZNN6_ECO24, A0A0E1SUZ5_ECOLX, Q1RA10_ECOUT, A0A0H2Z0D8_ECOK1, B1LNY1_ECOSM, A0A140N6I2_ECOBD, D6I9D1_ECOLX, F4NEF2_ECOLX, A0A2S7SP53_ESCFE, A0A0H3EZW4_ECOLW, A0A181WMN6_KLEOX, B7UTA0_ECO27, B7MDL3_ECO45, B7L9T6_ECO55, B7NC96_ECOLU, A0A0H3MFS7_ECO7I, B7MWK3_ECO81, A0A1S9J9N1_SHIBO, A0A0I4U8I3_SHISO, G1UGH7_ECOLX, A0A1X3JEA4_ECOLX, A0A1X3L106_ECOLX, F4VGZ1_ECOLX, A0A1X3I5J4_ECOLX, A0A0K9TA06_ECOLX, F4T1D1_ECOLX, A0A1X3LL71_ECOLX, A0A1X3LZ76_ECOLX, A0A1X3IZT9_ECOLX, E9XIF6_ECOLX, E1IJ79_ECOLX, D8E5C2_ECOLX, A0A0E1M3G6_ECOLX, D8A541_ECOMS, D7Y090_ECOM1, E9TE85_ECOLX, WZA_ECOLI, WZA_ECO57, F0JVV6_ESCFE
KEGG ID ecz:ECS88_2159, ecv:APECO1_1152, eci:UTI89_C2336, ect:ECIAI39_0953, ecw:EcE24377A_2355, ecm:EcSMS35_1000, ecs:ECs2867, esl:O3K_09115, elw:ECW_m2219, ecj:JW2047, ece:Z3227, eco:b2062, ebd:ECBD_1593, elo:EC042_2299, eck:EC55989_2318, eum:ECUMN_2398, ecg:E2348C_2204, ecq:ECED1_2408
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Poly_export PF02563.18 8.8e-27 81..165
Wza_C PF18412.3 6e-16 347..376
SLBB PF10531.11 1.9e-07 173..221

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-379 MMKSKMKLMPLLVSVTLISGCTVLPGSNMSTMGKDVIKQQDADFDLDKMVNVYPLTPRLIDQLRPRPNVARPNMTLESEIANYQYRVGPGDVLNVTVWDHPELTTPAGQYRSSSDTGNWVQPDGTMFYPYIGKVHVVGKTLAEIRSDITGRLATYIADPQVDVNIAAFRSQKAYISGQVNKSGQQAITNVPLTILDAINAAGGLTDTADWRNVVLTHNGREERISLQALMQNGDLNQNRLLYPGDILYVPRNDDLKVFVMGEVKKQSTLKMDFSGMTLTEALGNAEGIDMTTSNASGIFVIRPLKGEGGRNGKIANIYQLDMSDATSLVMATEFRLQPYDVVYVTTAPVSRWNRLINQLLPTISGVRYMTDTASDIHNW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9986 pos: 20-21. ISG-CT. MMKSKMKLMPLLVSVTLISG



  Protein sequence: 380 a.a.    .

>RSF000028 NZ_CP009273:c2130724-2129585 [Escherichia coli BW25113]
MMKSKMKLMPLLVSVTLISGCTVLPGSNMSTMGKDVIKQQDADFDLDKMVNVYPLTPRLIDQLRPRPNVARPNMTLESEI
ANYQYRVGPGDVLNVTVWDHPELTTPAGQYRSSSDTGNWVQPDGTMFYPYIGKVHVVGKTLAEIRSDITGRLATYIADPQ
VDVNIAAFRSQKAYISGQVNKSGQQAITNVPLTILDAINAAGGLTDTADWRNVVLTHNGREERISLQALMQNGDLNQNRL
LYPGDILYVPRNDDLKVFVMGEVKKQSTLKMDFSGMTLTEALGNAEGIDMTTSNASGIFVIRPLKGEGGRNGKIANIYQL
DMSDATSLVMATEFRLQPYDVVYVTTAPVSRWNRLINQLLPTISGVRYMTDTASDIHNW*

  Nucleotide sequence: 1140 bp    .

>RSF000028 NZ_CP009273:c2130724-2129585 [Escherichia coli BW25113]
ATGATGAAATCCAAAATGAAATTGATGCCATTATTGGTGTCAGTAACCTTGATAAGCGGTTGCACAGTACTTCCGGGCAG
CAATATGTCGACGATGGGCAAAGACGTCATCAAACAGCAGGACGCTGATTTCGATCTCGACAAAATGGTGAATGTTTATC
CGCTGACCCCGCGCCTGATTGACCAATTACGCCCACGCCCGAATGTAGCGCGCCCCAATATGACGCTGGAAAGTGAGATC
GCGAATTACCAGTATCGCGTCGGGCCGGGGGACGTTCTTAATGTCACCGTCTGGGATCACCCGGAACTCACCACGCCAGC
CGGTCAGTACCGCAGCTCCAGCGACACCGGCAACTGGGTACAGCCTGACGGCACTATGTTTTACCCGTATATCGGCAAGG
TCCACGTAGTCGGGAAAACGCTCGCTGAAATCCGCAGTGATATTACCGGGCGCTTAGCGACGTACATCGCTGACCCGCAG
GTGGACGTTAATATCGCCGCCTTCCGCTCACAAAAGGCCTATATCTCCGGTCAGGTGAATAAATCCGGTCAACAGGCGAT
CACCAACGTGCCACTGACTATTCTCGACGCCATCAACGCCGCAGGTGGCCTGACCGACACCGCTGACTGGCGCAACGTGG
TGCTAACACACAATGGTCGTGAAGAGCGCATTTCTTTGCAGGCGCTGATGCAAAACGGCGACCTCAACCAGAATCGCCTG
CTTTACCCCGGCGATATTCTCTACGTGCCACGTAATGATGATCTGAAAGTATTTGTGATGGGTGAAGTGAAGAAACAGAG
CACCCTGAAAATGGACTTTAGCGGCATGACCCTGACTGAAGCCCTGGGCAATGCTGAAGGCATCGACATGACCACCTCCA
ACGCCAGCGGCATCTTTGTCATTCGTCCGCTGAAAGGCGAGGGCGGGCGTAACGGCAAGATTGCCAATATCTACCAGCTG
GATATGTCCGATGCCACGTCGCTGGTGATGGCGACAGAATTCCGCCTGCAACCTTATGACGTGGTGTATGTCACCACCGC
CCCGGTTTCCCGCTGGAACCGTCTGATCAATCAGTTGCTGCCAACTATTAGCGGTGTCCGTTACATGACGGATACAGCCA
GCGACATTCATAACTGGTAA