Detailed information of Recipient susceptibility factor


Summary

ID RSF000027 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (475 a.a.); Nucleotide sequence (1425 bp)
Response to T6SS attack protective
Known or putative function Maintaining envelope integrity
Description Maintaining envelope integrity was important for surviving TseH attacks, and deletion periplasmic protease and chaperone DegP involved in this process showed impaired survival when challenged with the TseH WT strain.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS00810 (degP)
Coordinates (Strand) 177371..178795 (+)
NCBI ID 446676600
RefSeq NZ_CP009273
Uniprot ID S1EBK7_ECOLX, L3QHT5_ECOLX, L4JG49_ECOLX, U9XL22_ECOLX, U9XSD1_ECOLX, V0A2W1_ECOLX, V0Z4C3_ECOLX, U9ZII1_ECOLX, A0A080JBX1_ECOLX, E3PDB4_ECOH1, A0A0E1SVN9_ECOLX, A0A140NAV6_ECOBD, A0A0H3PJI5_ECO5C, D6IID4_ECOLX, D6J624_ECOLX, F4NQV4_ECOLX, C3TPR2_ECOLX, E0IYM0_ECOLW, B7N830_ECOLU, A0A237FWH1_SHIBO, A0A1Q8NRY0_SHIDY, A0A0I2TNG1_SHISO, A0A1X3JNL6_ECOLX, A0A1X3LBR7_ECOLX, F4VNQ3_ECOLX, A0A1X3IC92_ECOLX, A0A0K9TI34_ECOLX, F4T9Z7_ECOLX, A0A1X3L993_ECOLX, A0A1X3J7X5_ECOLX, A0A0E1LV58_ECOLX, D7Y754_ECOM1, I4T698_ECOLX, DEGP_ECOLI, DEGP_ECO57
KEGG ID eco:b0161, eum:ECUMN_0159, ece:Z0173, ebd:ECBD_3457, ecj:JW0157, elh:ETEC_0157, ecs:ECs0165, elw:ECW_m0158
PDB ID 6JJK, 6JJO, 2ZLE, 3CS0, 6JJL, 3MH5, 3MH6, 3OU0, 1KY9, 3OTP, 3MH4, 3MH7, 4A8D

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Trypsin_2 PF13365.8 3.8e-31 114..250
PDZ_2 PF13180.8 1.8e-15 297..380
PDZ PF00595.26 4.2e-12 393..463

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-474 MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9971 pos: 26-27. ATA-AE. MKKTTLALSALALSLGLALSPLSATA



  Protein sequence: 475 a.a.    .

>RSF000027 NZ_CP009273:177371-178795 [Escherichia coli BW25113]
MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDS
PFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRS
DIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGAL
VNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVL
PNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGA
EMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ*

  Nucleotide sequence: 1425 bp    .

>RSF000027 NZ_CP009273:177371-178795 [Escherichia coli BW25113]
ATGAAAAAAACCACATTAGCACTGAGTGCACTGGCTCTGAGTTTAGGTTTGGCGTTATCTCCGCTCTCTGCAACGGCGGC
TGAGACTTCTTCAGCAACGACAGCCCAGCAGATGCCAAGCCTTGCACCGATGCTCGAAAAGGTGATGCCTTCAGTGGTCA
GCATTAACGTAGAAGGTAGCACAACCGTTAATACGCCGCGTATGCCGCGTAATTTCCAGCAGTTCTTCGGTGATGATTCT
CCGTTCTGCCAGGAAGGTTCTCCGTTCCAGAGCTCTCCGTTCTGCCAGGGTGGCCAGGGCGGTAATGGTGGCGGCCAGCA
ACAGAAATTCATGGCGCTGGGTTCCGGCGTCATCATTGATGCCGATAAAGGCTATGTCGTCACCAACAACCACGTTGTTG
ATAACGCGACGGTCATTAAAGTTCAACTGAGCGATGGCCGTAAGTTCGACGCGAAGATGGTTGGCAAAGATCCGCGCTCT
GATATCGCGCTGATCCAAATCCAGAACCCGAAAAACCTGACCGCAATTAAGATGGCGGATTCTGATGCACTGCGCGTGGG
TGATTACACCGTAGCGATTGGTAACCCGTTTGGTCTGGGCGAGACGGTAACTTCCGGGATTGTCTCTGCGCTGGGGCGTA
GCGGCCTGAATGCCGAAAACTACGAAAACTTCATCCAGACCGATGCAGCGATCAACCGTGGTAACTCCGGTGGTGCGCTG
GTTAACCTGAACGGCGAACTGATCGGTATCAACACCGCGATCCTCGCACCGGACGGCGGCAACATCGGTATCGGTTTTGC
TATCCCGAGTAACATGGTGAAAAACCTGACCTCGCAGATGGTGGAATACGGCCAGGTGAAACGCGGTGAGCTGGGTATTA
TGGGGACTGAGCTGAACTCCGAACTGGCGAAAGCGATGAAAGTTGACGCCCAGCGCGGTGCTTTCGTAAGCCAGGTTCTG
CCTAATTCCTCCGCTGCAAAAGCGGGCATTAAAGCGGGTGATGTGATCACCTCACTGAACGGTAAGCCGATCAGCAGCTT
TGCCGCACTGCGTGCTCAGGTGGGTACTATGCCGGTAGGCAGCAAACTGACCCTGGGCTTACTGCGCGACGGTAAGCAGG
TTAACGTGAACCTGGAACTGCAGCAGAGCAGCCAGAATCAGGTTGATTCCAGCTCCATCTTCAACGGCATTGAAGGCGCT
GAGATGAGCAACAAAGGCAAAGATCAGGGCGTGGTAGTGAACAACGTGAAAACGGGCACTCCGGCTGCGCAGATCGGCCT
GAAGAAAGGTGATGTGATTATTGGCGCGAACCAGCAGGCAGTGAAAAACATCGCTGAACTGCGTAAAGTTCTCGACAGCA
AACCGTCTGTGCTGGCACTCAACATTCAGCGCGGCGACAGCACCATCTACCTGTTAATGCAGTAA