Detailed information of Recipient susceptibility factor


Summary

ID RSF000019 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (217 a.a.); Nucleotide sequence (651 bp)
Response to T6SS attack protective
Known or putative function anti-sigma-E factor
Description When co-incubated with T6SS-active 4effc compared with the ΔvasK mutant, whereas the tolB mutant showed considerable cell lysis but a nonsignificant difference between 4effc and ΔvasK. Competition assays show that survival of tolB and rseA was significantly reduced by 4effc.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS13420 (rseA)
Coordinates (Strand) 2702113..2702763 (-)
NCBI ID 447091203
RefSeq NZ_CP009273
Uniprot ID A0A0E0XXB1_ECO1C, K4W8J3_ECOLX, S1ESU4_ECOLX, L3Q147_ECOLX, L4J474_ECOLX, U9YQ82_ECOLX, U9XME1_ECOLX, V0SQF3_ECOLX, U9ZQ44_ECOLX, V0VL40_ECOLX, V0Z1I6_ECOLX, U9ZJM7_ECOLX, A0A080IUC7_ECOLX, A0A0A0FD10_ECOLX, RSEA_ECOL6, D3H3T2_ECO44, Q32CU9_SHIDS, E3PGW2_ECOH1, A7ZQ16_ECO24, A0A0E1SVJ2_ECOLX, Q1R8G0_ECOUT, B1LP85_ECOSM, A0A140N9I3_ECOBD, D6IA08_ECOLX, D6JD47_ECOLX, F4NGK2_ECOLX, E2QQ32_ECOLX, E0J4I8_ECOLW, A0A181WNC0_KLEOX, B7UH12_ECO27, B7LUZ2_ESCF3, B7LDG5_ECO55, B7N6G0_ECOLU, A0A2S8D9Q1_SHIDY, A0A0K9TE70_ECOLX, A0A1X3LGM9_ECOLX, A0A1X3M0T3_ECOLX, E9XI67_ECOLX, E6BH03_ECOLX, E1IN63_ECOLX, E1J3R0_ECOLX, D8E295_ECOLX, A0A0H3EJX9_ECO8N, A0A0E1M0C2_ECOLX, D7XMV2_ECOLX, D7Y9T8_ECOM1, E9TC10_ECOLX, I4T734_ECOLX, RSEA_ECOLI, I2USR9_ECOLX, I2WVG3_ECOLX
KEGG ID eum:ECUMN_2894, elw:ECW_m2801, ecm:EcSMS35_2725, eci:UTI89_C2894, ecj:JW2556, eco:b2572, ecg:E2348C_2849, efe:EFER_0502, ecw:EcE24377A_2858, esl:O3K_06550, eln:NRG857_12770, sdy:SDY_2813, elh:ETEC_2785, ecc:c3096, elo:EC042_2776, ebd:ECBD_1109, eck:EC55989_2861
PDB ID 1OR7, 3M4W, 1YFN

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RseA_N PF03872.15 1.1e-36 1..87
RseA_C PF03873.15 1.5e-25 132..186

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9946 - -



  Protein sequence: 217 a.a.    .

>RSF000019 NZ_CP009273:c2702763-2702113 [Escherichia coli BW25113]
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQP
APHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANN
GQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ*

  Nucleotide sequence: 651 bp    .

>RSF000019 NZ_CP009273:c2702763-2702113 [Escherichia coli BW25113]
ATGCAGAAAGAACAACTTTCCGCTTTAATGGATGGCGAAACGCTGGATAGTGAGCTGCTTAACGAACTGGCTCATAACCC
AGAAATGCAGAAAACCTGGGAAAGCTATCACTTAATCCGTGACTCAATGCGGGGTGATACTCCCGAGGTGCTCCATTTCG
ATATCTCTTCACGCGTGATGGCCGCCATTGAAGAAGAGCCAGTACGTCAACCGGCGACATTGATCCCGGAAGCCCAGCCT
GCGCCGCATCAATGGCAGAAAATGCCATTCTGGCAGAAAGTACGTCCGTGGGCGGCACAGCTTACCCAAATGGGCGTAGC
CGCATGCGTATCGCTTGCAGTTATCGTTGGCGTCCAGCACTATAATGGACAATCTGAAACGTCCCAGCAGCCCGAAACGC
CGGTATTTAATACACTGCCGATGATGGGTAAAGCCAGCCCGGTAAGCCTGGGAGTACCTTCTGAAGCGACCGCAAACAAT
GGTCAACAGCAGCAGGTACAGGAGCAGCGTCGTCGCATTAATGCAATGTTGCAGGATTACGAACTGCAACGCCGACTCCA
CTCTGAACAGCTTCAGTTTGAGCAGGCGCAAACCCAGCAAGCCGCTGTACAGGTGCCAGGAATTCAAACTTTAGGAACGC
AATCGCAGTAA