Detailed information of Recipient susceptibility factor


Summary

ID RSF000018 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (431 a.a.); Nucleotide sequence (1293 bp)
Response to T6SS attack protective
Known or putative function Tol-Pal system protein
Description When co-incubated with T6SS-active 4effc compared with the ΔvasK mutant, whereas the tolB mutant showed considerable cell lysis but a nonsignificant difference between 4effc and ΔvasK. Competition assays show that survival of tolB and rseA was significantly reduced by 4effc.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS03840 (tolB)
Coordinates (Strand) 773196..774488 (+)
NCBI ID 481023805
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y2D6_ECO1C, K4X2P0_ECOLX, S1PL24_ECOLX, S1ETH5_ECOLX, L3QCT1_ECOLX, L4JFQ5_ECOLX, A0A0E2LMS3_ECOU3, A0A080JCX5_ECOLX, A0A0A0F9G1_ECOLX, TOLB_ECOL6, D3GY88_ECO44, TOLB_ECODH, E3PHC9_ECOH1, TOLB_ECO24, A0A0E1T5V1_ECOLX, TOLB_ECOL5, TOLB_ECOUT, TOLB_ECO5E, A0A140NEI9_ECOBD, A0A0H3PPH9_ECO5C, TOLB_ECOLC, D6I6W7_ECOLX, D6J861_ECOLX, E0J6E7_ECOLW, A0A168UEE2_KLEOX, TOLB_ECO27, TOLB_ECO45, TOLB_ECO55, TOLB_ECOLU, TOLB_ECO7I, TOLB_ECO81, TOLB_ECOBW, A0A237F8P9_SHIBO, A0A0H9UZS2_SHISO, A0A1X3JK31_ECOLX, A0A1X3L3Z9_ECOLX, F4VBH1_ECOLX, A0A1X3I8M7_ECOLX, A0A0K9TEN3_ECOLX, F4SWU9_ECOLX, F4TBV4_ECOLX, A0A1X3LGP8_ECOLX, A0A1X3J4D1_ECOLX, E9XNR8_ECOLX, A0A0H3EGL3_ECO8N, A0A0E1LZ85_ECOLX, I4SM07_ECOLX, TOLB_ECOLI, TOLB_ECO57, I2UMH1_ECOLX, I2WSF6_ECOLX
KEGG ID ece:Z0908, ecp:ECP_0751, ecj:JW5100, ecg:E2348C_0624, eln:NRG857_03300, elw:ECW_m0795, eck:EC55989_0725, ecf:ECH74115_0843, esl:O3K_17935, ecs:ECs0775, elh:ETEC_0751, eco:b0740, ebd:ECBD_2920, ecq:ECED1_0707, ecl:EcolC_2915, eci:UTI89_C0736, ecc:c0819, ebw:BWG_0599, elo:EC042_0766, ect:ECIAI39_0715, ecw:EcE24377A_0769, eum:ECUMN_0828, ecz:ECS88_0763, ecd:ECDH10B_0807
PDB ID 7NSU, 2W8B, 1CRZ, 7NST, 1C5K, 2IVZ, 3IAX, 2HQS

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TolB_N PF04052.15 7.1e-30 24..121
PD40 PF07676.14 5.7e-10 281..315
PD40 PF07676.14 4.8e-09 237..272

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-430 MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9821 pos: 21-22. LHA-EV. MKQALRVAFGFLILWASVLHA



  Protein sequence: 431 a.a.    .

>RSF000018 NZ_CP009273:773196-774488 [Escherichia coli BW25113]
MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQP
GSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIK
GAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVA
SFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNIN
GGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSV
LNLVSTDGRFKARLPATDGQVKFPAWSPYL*

  Nucleotide sequence: 1293 bp    .

>RSF000018 NZ_CP009273:773196-774488 [Escherichia coli BW25113]
ATGAAGCAGGCATTACGAGTAGCATTTGGTTTTCTCATACTGTGGGCATCAGTTCTGCATGCTGAAGTCCGCATTGTGAT
CGACAGCGGTGTAGATTCCGGTCGTCCTATTGGTGTTGTTCCTTTCCAGTGGGCGGGGCCTGGTGCGGCACCTGAAGATA
TTGGCGGCATCGTTGCTGCTGACTTGCGTAACAGCGGTAAATTTAATCCGTTAGATCGCGCTCGTCTGCCACAGCAGCCG
GGTAGTGCGCAGGAAGTACAACCAGCTGCATGGTCCGCACTGGGCATTGACGCTGTAGTTGTCGGTCAGGTCACTCCGAA
TCCGGATGGTTCTTACAATGTTGCTTATCAACTTGTTGACACTGGCGGCGCACCGGGTACTGTACTTGCTCAGAACTCGT
ACAAAGTGAACAAGCAGTGGCTGCGTTATGCTGGTCATACCGCCAGTGATGAAGTGTTTGAAAAACTGACCGGCATTAAA
GGTGCGTTCCGTACTCGTATTGCCTACGTTGTTCAGACCAACGGCGGTCAGTTCCCGTATGAACTGCGCGTATCTGACTA
TGACGGTTACAACCAGTTTGTCGTTCACCGTTCACCGCAGCCGCTGATGTCTCCGGCGTGGTCACCAGACGGTTCTAAAC
TGGCTTATGTGACCTTCGAAAGCGGTCGTTCCGCGCTGGTTATTCAGACGCTGGCAAATGGCGCTGTACGTCAGGTGGCT
TCATTCCCGCGTCACAACGGTGCACCTGCATTCTCGCCAGACGGCAGCAAACTGGCATTCGCCTTGTCGAAAACCGGTAG
TCTGAACCTGTACGTAATGGATTTGGCTTCTGGTCAGATCCGCCAGGTGACTGATGGTCGCAGTAACAATACCGAACCGA
CCTGGTTCCCGGATAGCCAGAACCTGGCATTTACTTCTGACCAGGCCGGTCGTCCGCAGGTTTATAAAGTGAATATCAAC
GGCGGTGCGCCACAACGTATTACCTGGGAAGGTTCGCAGAACCAGGATGCGGATGTCAGCAGCGACGGTAAATTTATGGT
AATGGTCAGCTCCAATGGTGGGCAGCAGCACATTGCCAAACAAGATCTGGCAACGGGAGGCGTACAAGTTCTGTCGTCCA
CGTTCCTGGATGAAACGCCAAGTCTGGCACCTAACGGCACTATGGTAATCTACAGCTCTTCTCAGGGGATGGGATCCGTG
CTGAATTTGGTTTCTACAGATGGGCGTTTCAAAGCGCGTCTTCCGGCAACTGATGGACAGGTCAAATTCCCTGCCTGGTC
GCCGTATCTGTGA