Detailed information of Recipient susceptibility factor


Summary

ID RSF000017 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (202 a.a.); Nucleotide sequence (606 bp)
Response to T6SS attack protective
Known or putative function Osmotic stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS22785 (osmY)
Coordinates (Strand) 4601213..4601818 (+)
NCBI ID 481041372
RefSeq NZ_CP009273
Uniprot ID K4XMA2_ECOLX, S1NME1_ECOLX, S1E2S3_ECOLX, L3QFJ6_ECOLX, L4JGW6_ECOLX, U9YUN5_ECOLX, U9XN33_ECOLX, U9ZAB1_ECOLX, V0VF36_ECOLX, V0ZMB5_ECOLX, U9ZQB8_ECOLX, A0A0E2KWX7_ECOU3, A0A080I7J3_ECOLX, A0A0A0F9Z3_ECOLX, OSMY_ECOL6, D3GY15_ECO44, A0A0H2Z6L9_ECOK1, D6J695_ECOLX, E0J446_ECOLW, A0A170RK33_KLEOX, B7UR03_ECO27, B7MNI2_ECO45, B7NH43_ECOLU, A0A0H3MTB7_ECO7I, A0A1S9KHH9_SHIDY, A0A0H8K5P1_SHISO, E6BJD6_ECOLX, E1J593_ECOLX, D8ECM0_ECOLX, A0A0H3EQV4_ECO8N, A0A0E1M9T8_ECOLX, D7XQP9_ECOLX, D7Y3U9_ECOM1, OSMY_ECOLI, I2UPV4_ECOLX, I2WSE1_ECOLX
KEGG ID eum:ECUMN_4999, elw:ECW_m4737, elo:EC042_4872, ecv:APECO1_2005, ecz:ECS88_5056, ecc:c5457, ecg:E2348C_4673, eln:NRG857_22120, ecj:JW4338, ect:ECIAI39_4904, eco:b4376
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
BON PF04972.19 3.8e-20 55..122
BON PF04972.19 9.6e-20 135..199

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-201 MTMTRLKISKTLLAVMLTSAVATGSAYAENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9936 pos: 28-29. AYA-EN. MTMTRLKISKTLLAVMLTSAVATGSAYA



  Protein sequence: 202 a.a.    .

>RSF000017 NZ_CP009273:4601213-4601818 [Escherichia coli BW25113]
MTMTRLKISKTLLAVMLTSAVATGSAYAENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISV
KTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVE
TTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK*

  Nucleotide sequence: 606 bp    .

>RSF000017 NZ_CP009273:4601213-4601818 [Escherichia coli BW25113]
ATGACTATGACAAGACTGAAGATTTCGAAAACTCTGCTGGCTGTAATGTTGACCTCTGCCGTCGCGACCGGCTCTGCCTA
CGCGGAAAACAACGCGCAGACTACCAATGAAAGCGCAGGGCAAAAAGTCGATAGCTCTATGAATAAAGTCGGTAATTTCA
TGGATGACAGCGCCATCACCGCGAAAGTGAAGGCGGCCCTGGTGGATCATGACAACATCAAGAGCACCGATATCTCTGTA
AAAACCGATCAAAAAGTCGTGACCCTGAGCGGTTTCGTTGAAAGCCAGGCCCAGGCCGAAGAGGCAGTGAAAGTGGCGAA
AGGCGTTGAAGGGGTGACCTCTGTCAGCGACAAACTGCACGTTCGCGACGCTAAAGAAGGCTCGGTGAAGGGCTACGCGG
GTGACACCGCCACCACCAGTGAAATCAAAGCCAAACTGCTGGCGGACGATATCGTCCCTTCCCGTCATGTGAAAGTTGAA
ACCACCGACGGCGTGGTTCAGCTCTCCGGTACCGTCGATTCTCAGGCACAAAGTGACCGTGCTGAAAGTATCGCCAAAGC
GGTAGATGGTGTGAAAAGCGTTAAAAATGATCTGAAAACTAAGTAA