Detailed information of Recipient susceptibility factor


Summary

ID RSF000016 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (144 a.a.); Nucleotide sequence (432 bp)
Response to T6SS attack protective
Known or putative function Osmotic stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS07770 (osmC)
Coordinates (Strand) 1550882..1551313 (+)
NCBI ID 446074450
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y2W7_ECO1C, K4W0F8_ECOLX, S1PAJ4_ECOLX, S1EMF8_ECOLX, L3Q5W5_ECOLX, L4JA19_ECOLX, U9Y183_ECOLX, U9XWC5_ECOLX, V0SN47_ECOLX, U9ZNT4_ECOLX, V0V849_ECOLX, V0Y7D7_ECOLX, V0A139_ECOLX, D3GRL5_ECO44, E3PLY2_ECOH1, A7ZLS4_ECO24, A0A0E1SU26_ECOLX, A0A140NAD7_ECOBD, D6IAI0_ECOLX, D6J9T0_ECOLX, A0A170UHT2_KLEOX, B7L7I1_ECO55, B7N4P4_ECOLU, A0A0H3MGY0_ECO7I, B7MUR5_ECO81, OSMC_SHIFL, A0A2A2XT07_SHIFL, A0A1H0HUF9_SHISO, A0A1X3JHJ6_ECOLX, A0A1X3L2S6_ECOLX, F4VF80_ECOLX, A0A1X3I7A2_ECOLX, A0A0K9T634_ECOLX, F4SXY9_ECOLX, F4TFZ4_ECOLX, A0A1X3LJF7_ECOLX, A0A1X3LXJ5_ECOLX, A0A1X3J254_ECOLX, E6BQQ2_ECOLX, E1IT52_ECOLX, E1JCP8_ECOLX, D8ECT7_ECOLX, A0A0H3EHC5_ECO8N, A0A0E1LX64_ECOLX, D8ABI4_ECOMS, D7XVX2_ECOLX, D7Y0D3_ECOM1, E9T8V6_ECOLX, I4SHK5_ECOLX, OSMC_ECOLI, I2UGA3_ECOLX, I2WN09_ECOLX, A0A192C700_ECOLX, F0JQ61_ESCFE
KEGG ID eln:NRG857_07350, sfl:SF1743, eum:ECUMN_1736, elh:ETEC_1552, sfx:S1876, eck:EC55989_1614, elo:EC042_1614, ecw:EcE24377A_1664, ebd:ECBD_2157, eco:b1482, sft:NCTC1_01889, esl:O3K_13085, ecj:JW1477, ecq:ECED1_1634, ect:ECIAI39_1746
PDB ID 1QWI, 1NYE

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
OsmC PF02566.21 3.6e-19 43..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-143 MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9601 - -



  Protein sequence: 144 a.a.    .

>RSF000016 NZ_CP009273:1550882-1551313 [Escherichia coli BW25113]
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
TADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS*

  Nucleotide sequence: 432 bp    .

>RSF000016 NZ_CP009273:1550882-1551313 [Escherichia coli BW25113]
ATGACAATCCATAAGAAAGGTCAGGCACACTGGGAAGGCGATATCAAACGCGGGAAGGGAACAGTATCCACCGAGAGTGG
CGTGCTGAACCAACAGCCGTATGGATTTAACACGCGTTTTGAAGGCGAAAAAGGAACCAACCCTGAAGAACTGATTGGCG
CAGCGCATGCCGCATGTTTCTCAATGGCGCTTTCATTAATGCTGGGGGAAGCGGGATTCACGCCAACATCGATTGATACC
ACCGCCGATGTGTCGCTGGATAAAGTGGATGCCGGTTTTGCGATTACGAAAATCGCACTGAAGAGTGAAGTTGCGGTGCC
GGGTATTGATGCCTCTACCTTTGACGGCATAATCCAGAAAGCAAAAGCAGGATGCCCGGTCTCTCAGGTACTGAAAGCGG
AAATTACGCTGGATTACCAGTTGAAATCGTAA