Detailed information of Recipient susceptibility factor


Summary

ID RSF000015 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (73 a.a.); Nucleotide sequence (219 bp)
Response to T6SS attack protective
Known or putative function Osmotic stress response
Description osmB and bdm, which respond to osmotic stress, a potential consequence of peptidoglycan damage regulated by RcsB played a role in protecting against TseH-mediated killing, as the survival of the mutant strains was significantly reduced.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS06710 (osmB)
Coordinates (Strand) 1337367..1337585 (-)
NCBI ID 446420398
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y047_ECO1C, K4XKY6_ECOLX, S1PLM9_ECOLX, S1EZS9_ECOLX, L3Q975_ECOLX, L4JCQ2_ECOLX, U9YC03_ECOLX, U9YIG4_ECOLX, V0TEP3_ECOLX, U9ZTA7_ECOLX, V0Z6L1_ECOLX, V0ZCC1_ECOLX, V0AQV8_ECOLX, A0A0E2L6H5_ECOU3, A0A080J371_ECOLX, A0A0A0F9N5_ECOLX, OSMB_ECOL6, D3H3I7_ECO44, E3PL43_ECOH1, A7ZLA4_ECO24, A0A0E1SSN4_ECOLX, A0A2S4S1M3_CITAM, Q1RC81_ECOUT, B1LH05_ECOSM, A0A140NAV1_ECOBD, A0A0H3PQ42_ECO5C, D6I874_ECOLX, D6JAI2_ECOLX, F4NGS6_ECOLX, C3TC12_ECOLX, E0IUX7_ECOLW, B7MLV9_ECO45, B7L4B9_ECO55, B7N499_ECOLU, A0A0H3MHB2_ECO7I, B7MUC5_ECO81, A0A1Q8NU44_SHIDY, OSMB_SHIFL, A0A0I0QC36_SHISO, D2TL27_CITRI, A0A1X3JIZ1_ECOLX, A0A1X3L5D4_ECOLX, F4VBW5_ECOLX, A0A1X3I9X6_ECOLX, A0A0K9T7S5_ECOLX, F4SXJ3_ECOLX, F4TDI3_ECOLX, A0A1X3LIL5_ECOLX, A0A1X3LWX3_ECOLX, A0A1X3J1S8_ECOLX, E9XLW4_ECOLX, E6BMY8_ECOLX, E1IJW9_ECOLX, E1J7U5_ECOLX, D8E7D5_ECOLX, A0A0E1M194_ECOLX, D7XPL7_ECOLX, D7Y6G1_ECOM1, E9TF33_ECOLX, I4SIP1_ECOLX, OSMB_ECOLI, OSMB_ECO57, I2UFI4_ECOLX, I2WNZ5_ECOLX, A0A192C5K8_ECOLX
KEGG ID ebd:ECBD_2336, ecc:c1753, esl:O3K_13925, elo:EC042_1408, eci:UTI89_C1555, ect:ECIAI39_1624, eum:ECUMN_1586, eco:b1283, sfx:S1370, elw:ECW_m1377, ecm:EcSMS35_1845, ecw:EcE24377A_1486, ecz:ECS88_1424, elh:ETEC_1387, cro:ROD_17171, ecj:JW1275, eck:EC55989_1444, ecs:ECs1856, ecq:ECED1_1493, sfl:SF1287, ece:Z2523
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Rick_17kDa_Anti PF05433.17 9.1e-08 33..71

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-72 MFVTSKKMTAAVLAITLAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGAAVGGVIGHQVGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9956 pos: 23-24. LSA-CS. MFVTSKKMTAAVLAITLAMSLSA



  Protein sequence: 73 a.a.    .

>RSF000015 NZ_CP009273:c1337585-1337367 [Escherichia coli BW25113]
MFVTSKKMTAAVLAITLAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGAAVGGVIGHQVGK*

  Nucleotide sequence: 219 bp    .

>RSF000015 NZ_CP009273:c1337585-1337367 [Escherichia coli BW25113]
ATGTTTGTAACGAGCAAAAAAATGACCGCGGCTGTTCTGGCAATTACTTTGGCAATGTCTCTGAGTGCCTGTTCTAACTG
GTCTAAACGGGACCGCAACACCGCAATCGGCGCGGGTGCAGGGGCATTAGGCGGTGCAGTACTGACCGATGGCAGTACGT
TGGGTACATTAGGTGGTGCAGCTGTCGGAGGTGTTATTGGTCACCAGGTCGGTAAATAA