Detailed information of Recipient susceptibility factor


Summary

ID RSF000014 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (230 a.a.); Nucleotide sequence (690 bp)
Response to T6SS attack sensitive
Known or putative function phosphate response regulator transcription factor
Description Survival (killing by TseHWT/TseHH64a ) of E. coli ΔdegP mutant with vector (Vec) or overexpressing genes from yeeN and phoB is significant different.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS02065 (phoB)
Coordinates (Strand) 412598..413287 (+)
NCBI ID 446036078
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y4K3_ECO1C, K4WUV2_ECOLX, S1Q746_ECOLX, S1EVX8_ECOLX, L3QFZ3_ECOLX, L4JFF0_ECOLX, U9XX77_ECOLX, U9XU55_ECOLX, V0SXG8_ECOLX, U9Z5Z5_ECOLX, V0URF9_ECOLX, V0XND1_ECOLX, V0ZCN5_ECOLX, V0AGY7_ECOLX, A0A0E2LNM3_ECOU3, A0A080JA26_ECOLX, A0A2T3RXC0_9ESCH, D3GU91_ECO44, E3PFL5_ECOH1, A7ZIE9_ECO24, A0A0E1SZ49_ECOLX, Q1RFE3_ECOUT, A0A0H2YWN4_ECOK1, B1LIT3_ECOSM, A0A140NB44_ECOBD, A0A0H3PVM7_ECO5C, B1EKU1_ESCAT, D6I7B0_ECOLX, D6J6X4_ECOLX, A0A1X3JT03_9ESCH, F4NMF1_ECOLX, E0J0P0_ECOLW, A0A169RV99_KLEOX, B7UJM2_ECO27, B7MD57_ECO45, B7L553_ECO55, B7N8V0_ECOLU, A0A0H3MED7_ECO7I, B7MPF9_ECO81, A0A1Q8MKR3_SHIBO, A0A0I0SFM1_SHISO, A0A1X3JM12_ECOLX, A0A1X3L7D8_ECOLX, F4VAH8_ECOLX, A0A1X3KPU9_ECOLX, A0A1X3IC76_ECOLX, A0A0K9TB40_ECOLX, F4SUL3_ECOLX, F4TAQ4_ECOLX, A0A1X3LNC6_ECOLX, A0A1X3LTP1_ECOLX, A0A1X3J5Y3_ECOLX, E9XPQ6_ECOLX, E6BHM7_ECOLX, E1IPJ9_ECOLX, E1IZS4_ECOLX, D8E161_ECOLX, A0A0H3EGH5_ECO8N, A0A0E1LYE4_ECOLX, D8A4G4_ECOMS, D7XKD3_ECOLX, D7Y372_ECOM1, E9TLI8_ECOLX, I4SYP4_ECOLX, PHOB_ECOLI, PHOB_ECO57, I2UR06_ECOLX, I2WQL0_ECOLX, A0A192CIK5_ECOLX
KEGG ID eum:ECUMN_0436, ecj:JW0389, ecw:EcE24377A_0427, eci:UTI89_C0420, eco:b0399, elo:EC042_0431, ecv:APECO1_1611, ecz:ECS88_0393, ecm:EcSMS35_0429, eck:EC55989_0407, elh:ETEC_0451, ecs:ECs0449, ebd:ECBD_3262, eln:NRG857_01870, esl:O3K_19520, ecg:E2348C_0334, ect:ECIAI39_0283, ece:Z0497, elw:ECW_m0468, ecq:ECED1_0421
PDB ID 1QQI, 1GXP, 1GXQ, 2JB9, 1ZES, 2JBA, 2IYN, 3T72, 1B00, 2Z33

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 5.2e-29 5..117
Trans_reg_C PF00486.30 1.2e-28 151..225

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-229 MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9949 - -



  Protein sequence: 230 a.a.    .

>RSF000014 NZ_CP009273:412598-413287 [Escherichia coli BW25113]
MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVV
MLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEF
KLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF*

  Nucleotide sequence: 690 bp    .

>RSF000014 NZ_CP009273:412598-413287 [Escherichia coli BW25113]
ATGGCGAGACGTATTCTGGTCGTAGAAGATGAAGCTCCAATTCGCGAAATGGTCTGCTTCGTGCTCGAACAAAATGGCTT
TCAGCCGGTCGAAGCGGAAGATTATGACAGTGCTGTGAATCAACTGAATGAACCCTGGCCGGATTTAATTCTCCTCGACT
GGATGTTACCTGGCGGCTCCGGTATCCAGTTCATCAAACACCTCAAGCGCGAGTCGATGACCCGGGATATTCCAGTGGTG
ATGTTGACCGCCAGAGGGGAAGAAGAAGATCGCGTGCGCGGCCTTGAAACCGGCGCGGATGACTATATCACCAAGCCGTT
TTCGCCGAAGGAGCTGGTGGCGCGAATCAAAGCGGTAATGCGCCGTATTTCGCCAATGGCGGTGGAAGAGGTGATTGAGA
TGCAGGGATTAAGTCTCGACCCGACATCTCACCGAGTGATGGCGGGCGAAGAGCCGCTGGAGATGGGGCCGACAGAATTT
AAACTGCTGCACTTTTTTATGACGCATCCTGAGCGCGTGTACAGCCGCGAGCAGCTGTTAAACCACGTCTGGGGAACTAA
CGTGTATGTGGAAGACCGCACGGTCGATGTCCACATTCGTCGCCTGCGTAAAGCACTGGAGCCCGGCGGGCATGACCGCA
TGGTGCAGACCGTGCGCGGTACAGGATATCGTTTTTCAACCCGCTTTTAA