Detailed information of Recipient susceptibility factor


Summary

ID RSF000013 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (239 a.a.); Nucleotide sequence (717 bp)
Response to T6SS attack sensitive
Known or putative function YebC/PmpR family DNA-binding transcriptional regulator
Description Survival (killing by TseHWT/TseHH64a ) of E. coli ΔdegP mutant with vector (Vec) or overexpressing genes from yeeN and phoB is significant different.
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS10355 (YeeN)
Coordinates (Strand) 2050339..2051055 (+)
NCBI ID 446455068
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y0V0_ECO1C, K4WJS1_ECOLX, S1PZV1_ECOLX, L3Q818_ECOLX, U9Y172_ECOLX, V0S9C8_ECOLX, U9ZCX3_ECOLX, V0VF78_ECOLX, V0YCT0_ECOLX, V0YGW4_ECOLX, V0AI19_ECOLX, A0A0E2LJ22_ECOU3, YEEN_ECOL6, D3GYK4_ECO44, A0A0E1T8C8_ECOLX, YEEN_ECOL5, YEEN_ECOUT, A0A0H2Z046_ECOK1, B1LPW3_ECOSM, A0A140N7X1_ECOBD, D6I971_ECOLX, D6JBM4_ECOLX, A0A163X7H4_KLEOX, B7USY8_ECO27, B7MCP7_ECO45, B7L911_ECO55, B7NC19_ECOLU, A0A0H3MFB1_ECO7I, B7MWL0_ECO81, A0A1X3L0T5_ECOLX, A0A1X3I5A3_ECOLX, A0A0K9T9U9_ECOLX, A0A1X3LKI6_ECOLX, A0A1X3LZM7_ECOLX, E9XIL1_ECOLX, E6BRN2_ECOLX, D8E6I3_ECOLX, A0A0H3EIF0_ECO8N, D7XGN7_ECOLX, E9TFF3_ECOLX, YEEN_ECOLI, A0A192C865_ECOLX
KEGG ID ecz:ECS88_2051, ecj:JW1964, ecq:ECED1_2289, eco:b1983, eck:EC55989_2220, eci:UTI89_C2196, ecp:ECP_1956, ecv:APECO1_1069, eln:NRG857_09955, elo:EC042_2224, ecc:c2445, esl:O3K_09640, eum:ECUMN_2321, ebd:ECBD_1663, ecm:EcSMS35_1142, ecg:E2348C_2090, ect:ECIAI39_1062
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transcrip_reg PF01709.22 5.9e-78 4..235

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-238 VGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNKKGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTDLHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVANL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9814 - -



  Protein sequence: 239 a.a.    .

>RSF000013 NZ_CP009273:2050339-2051055 [Escherichia coli BW25113]
VGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFV
QGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNKKGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRD
VTEEEGNIVIYTEPTDLHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVANL*

  Nucleotide sequence: 717 bp    .

>RSF000013 NZ_CP009273:2050339-2051055 [Escherichia coli BW25113]
GTGGGACGTAAATGGGCCAATATTGTTGCTAAAAAAACGGCTAAAGACGGTGCAACGTCTAAAATTTATGCAAAATTCGG
TGTAGAAATCTATGCTGCTGCTAAACAAGGTGAACCCGATCCAGAATTAAACACATCTTTAAAATTCGTTATTGAACGTG
CAAAGCAGGCACAAGTTCCAAAGCACGTTATTGATAAAGCAATTGATAAAGCCAAAGGCGGCGGAGATGAAACGTTCGTG
CAGGGACGTTATGAAGGCTTTGGTCCTAATGGCTCAATGATTATCGCCGAGACATTGACTTCAAATGTTAACCGTACGAT
TGCTAACGTTCGCACAATTTTCAATAAAAAAGGCGGCAATATCGGAGCGGCAGGTTCTGTCAGCTATATGTTTGACAATA
CGGGTGTGATTGTATTTAAAGGGACAGACCCTGACCATATTTTTGAAATTTTACTTGAAGCTGAAGTTGATGTTCGTGAT
GTGACTGAAGAAGAAGGTAACATTGTTATTTATACTGAACCTACTGACCTTCATAAAGGAATCGCGGCTCTAAAAGCAGC
TGGAATCACTGAGTTCTCAACAACAGAATTAGAAATGATTGCTCAATCTGAAGTTGAGCTTTCCCCAGAAGATTTAGAAA
TCTTTGAAGGGCTTGTTGATGCCCTTGAAGATGACGACGATGTACAAAAAGTTTATCATAACGTCGCAAATCTCTAA