Detailed information of Recipient susceptibility factor


Summary

ID RSF000012 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (176 a.a.); Nucleotide sequence (528 bp)
Response to T6SS attack protective
Known or putative function Acid stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS18200 (gadE)
Coordinates (Strand) 3651726..3652253 (+)
NCBI ID 446498836
RefSeq NZ_CP009273
Uniprot ID A0A0E0XW79_ECO1C, K4X3S6_ECOLX, S1NWV0_ECOLX, S1E956_ECOLX, L4IY49_ECOLX, A0A0E2L0D7_ECOU3, GADE_ECOL6, D3H0W0_ECO44, E3PMA2_ECOH1, A7ZT52_ECO24, A0A0E1SRG5_ECOLX, B1LJ54_ECOSM, A0A140N6Z5_ECOBD, A0A0H3PX58_ECO5C, D6IF87_ECOLX, D6JGH1_ECOLX, E0IZK9_ECOLW, B7UL65_ECO27, B7MEL4_ECO45, B7L5Z6_ECO55, B7NEF5_ECOLU, A0A0H3MLZ5_ECO7I, B7N1V3_ECO81, A0A1S9JH60_SHIBO, A0A1S9K0K0_SHIDY, GADE_SHIFL, A0A1W2N1L1_SHIFL, A0A0H7K8R4_SHISO, A0A0K9TG51_ECOLX, A0A1X3LD29_ECOLX, A0A1X3LQ58_ECOLX, E9XSV0_ECOLX, A0A0H3EQ74_ECO8N, A0A0E1M4M1_ECOLX, I4SKK2_ECOLX, GADE_ECOLI, GADE_ECO57, I2UK53_ECOLX, I2X0J6_ECOLX
KEGG ID ecg:E2348C_3754, eln:NRG857_17445, ecw:EcE24377A_3998, eco:b3512, ecs:ECs4392, ecq:ECED1_4190, sft:NCTC1_03828, eum:ECUMN_4012, esl:O3K_01350, elw:ECW_m3773, ece:Z4925, ebd:ECBD_0229, ecz:ECS88_3924, ecc:c4323, eck:EC55989_3955, elh:ETEC_3758, ecj:JW3480, ecm:EcSMS35_3814, sfl:SF3546, elo:EC042_3806, sfx:S4221, ect:ECIAI39_4014
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GerE PF00196.21 1.4e-05 117..167

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-175 MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKFLEKLDAERIIVLAPYHISKLKAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQFKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKLRRMSDIVTLGITSYF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9947 - -



  Protein sequence: 176 a.a.    .

>RSF000012 NZ_CP009273:3651726-3652253 [Escherichia coli BW25113]
MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKFLEKLDAERIIVLAPYHISKL
KAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQFKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKL
RRMSDIVTLGITSYF*

  Nucleotide sequence: 528 bp    .

>RSF000012 NZ_CP009273:3651726-3652253 [Escherichia coli BW25113]
ATGATTTTTCTCATGACGAAAGATTCTTTTCTTTTACAGGGCTTTTGGCAGTTGAAAGATAATCACGAAATGATAAAAAT
CAATTCCCTGTCAGAGATCAAAAAAGTAGGCAATAAACCCTTCAAGGTTATCATTGATACCTATCACAATCATATCCTTG
ATGAAGAAGCGATTAAATTTCTGGAGAAATTAGATGCCGAGAGAATTATTGTTTTGGCACCTTATCACATCAGTAAACTA
AAAGCTAAAGCGCCTATTTATTTTGTTAGCCGCAAAGAAAGTATCAAAAATCTTCTTGAGATTACTTATGGTAAACACTT
GCCCCATAAGAATTCACAATTATGTTTTTCACATAATCAGTTCAAAATTATGCAACTGATTCTGAAAAATAAAAATGAAA
GCAATATCACGTCGACGCTCAATATTTCGCAACAAACATTAAAGATTCAGAAATTCAACATTATGTACAAGCTGAAACTA
AGACGTATGAGCGACATCGTCACCCTGGGTATCACATCTTATTTTTAG