Detailed information of Recipient susceptibility factor


Summary

ID RSF000011 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (512 a.a.); Nucleotide sequence (1536 bp)
Response to T6SS attack protective
Known or putative function Acid stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS07820 (gadC)
Coordinates (Strand) 1563211..1564746 (-)
NCBI ID 446168164
RefSeq NZ_CP009273
Uniprot ID K4XLQ1_ECOLX, U9XWD2_ECOLX, A0A080J1W4_ECOLX, A0A0A0FFF8_ECOLX, E3PLZ2_ECOH1, A7ZLU0_ECO24, A0A0E1T0E3_ECOLX, A0A140NAC9_ECOBD, F4NG05_ECOLX, E0J6C9_ECOLW, B7L7J1_ECO55, A0A1Q8MD55_SHIBO, GADC_SHIFL, A0A0I2C196_SHISO, A0A1X3JHP3_ECOLX, A0A1X3L2L7_ECOLX, F4VF91_ECOLX, A0A1X3LJA3_ECOLX, A0A1X3J2C6_ECOLX, E6BQR3_ECOLX, E1IT63_ECOLX, E1JCR0_ECOLX, A0A0E1M1Q4_ECOLX, D7XVW2_ECOLX, D7Y0C2_ECOM1, E9T8U4_ECOLX, I4SHH8_ECOLX, GADC_ECOLI, I2UGB7_ECOLX, I2WPI0_ECOLX
KEGG ID eco:b1492, sfx:S1868, ecw:EcE24377A_1681, elh:ETEC_1562, eck:EC55989_1624, ebd:ECBD_2147, elw:ECW_m1620, ecj:JW1487, sfl:SF1735
PDB ID 4DJI, 4DJK

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AA_permease_2 PF13520.8 1.4e-52 13..451

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-12 MATSVQTGKAKQ
Transmembrane helix 13-30 LTLLGFFAITASMVMAVY
Outside 31-39 EYPTFATSG
Transmembrane helix 40-62 FSLVFFLLLGGILWFIPVGLCAA
Inside 63-94 EMATVDGWEEGGVFAWVSNTLGPRWGFAAISF
Transmembrane helix 95-117 GYLQIAIGFIPMLYFVLGALSYI
Outside 118-131 LKWPALNEDPITKT
Transmembrane helix 132-151 IAALIILWALALTQFGGTKY
Inside 152-157 TARIAK
Transmembrane helix 158-180 VGFFAGILLPAFILIALAAIYLH
Outside 181-194 SGAPVAIEMDSKTF
Transmembrane helix 195-217 FPDFSKVGTLVVFVAFILSYMGV
Inside 218-237 EASATHVNEMSNPGRDYPLA
Transmembrane helix 238-260 MLLLMVAAICLSSVGGLSIAMVI
Outside 261-287 PGNEINLSAGVMQTFTVLMSHVAPEIE
Transmembrane helix 288-310 WTVRVISALLLLGVLAEIASWIV
Inside 311-334 GPSRGMYVTAQKNLLPAAFAKMNK
Transmembrane helix 335-357 NGVPVTLVISQLVITSIALIILT
Outside 358-371 NTGGGNNMSFLIAL
Transmembrane helix 372-394 ALTVVIYLCAYFMLFIGYIVLVL
Inside 395-406 KHPDLKRTFNIP
Transmembrane helix 407-429 GGKGVKLVVAIVGLLTSIMAFIV
Outside 430-443 SFLPPDNIQGDSTD
Transmembrane helix 444-466 MYVELLVVSFLVVLALPFILYAV
Inside 467-511 HDRKGKANTGVTLEPINSQNAPKGHFFLHPRARSPHYIVMNDKKH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9886 - -



  Protein sequence: 512 a.a.    .

>RSF000011 NZ_CP009273:c1564746-1563211 [Escherichia coli BW25113]
MATSVQTGKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWVS
NTLGPRWGFAAISFGYLQIAIGFIPMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGF
FAGILLPAFILIALAAIYLHSGAPVAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASATHVNEMSNPGRDYPLAMLL
LMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLGVLAEIASWIVGPSRGMYVTA
QKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIILTNTGGGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLK
RTFNIPGGKGVKLVVAIVGLLTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDRKGKANTGVTLE
PINSQNAPKGHFFLHPRARSPHYIVMNDKKH*

  Nucleotide sequence: 1536 bp    .

>RSF000011 NZ_CP009273:c1564746-1563211 [Escherichia coli BW25113]
ATGGCTACATCAGTACAGACAGGTAAAGCTAAGCAGCTCACATTACTTGGATTCTTTGCCATAACGGCATCGATGGTAAT
GGCTGTTTATGAATACCCTACCTTCGCAACATCGGGCTTTTCATTAGTCTTCTTCCTGCTATTAGGCGGGATTTTATGGT
TTATTCCCGTGGGACTTTGTGCTGCGGAAATGGCCACCGTCGACGGCTGGGAAGAAGGTGGTGTCTTCGCCTGGGTATCA
AATACTCTGGGGCCGAGATGGGGATTTGCAGCGATCTCATTTGGCTATCTGCAAATCGCCATTGGTTTTATTCCGATGCT
CTATTTCGTGTTAGGGGCACTCTCCTACATCCTGAAATGGCCAGCGCTGAATGAAGACCCCATTACCAAAACTATTGCAG
CACTCATCATTCTTTGGGCGCTGGCATTAACGCAGTTTGGTGGCACGAAATACACGGCGCGAATTGCTAAAGTTGGCTTC
TTCGCCGGTATCCTGTTACCTGCATTTATTTTGATCGCATTAGCGGCTATTTATCTGCACTCCGGTGCCCCCGTTGCTAT
CGAAATGGATTCGAAGACCTTCTTCCCTGACTTCTCTAAAGTGGGCACCCTGGTAGTATTTGTTGCCTTCATTTTGAGTT
ATATGGGCGTAGAAGCATCCGCAACCCACGTCAATGAAATGAGCAACCCAGGGCGCGACTATCCGTTGGCTATGTTACTG
CTGATGGTGGCGGCAATCTGCTTAAGCTCTGTTGGTGGTTTGTCTATTGCGATGGTCATTCCGGGTAATGAAATCAACCT
CTCCGCAGGGGTAATGCAAACCTTTACCGTTCTGATGTCCCATGTGGCACCAGAAATTGAGTGGACGGTTCGCGTGATCT
CCGCACTGCTGTTGCTGGGTGTTCTGGCGGAAATCGCCTCCTGGATTGTTGGTCCTTCTCGCGGGATGTATGTAACAGCG
CAGAAAAACCTGCTGCCAGCGGCATTCGCTAAAATGAACAAAAATGGCGTACCGGTAACGCTGGTCATTTCGCAGCTGGT
GATTACGTCTATCGCGTTGATCATCCTCACCAATACCGGTGGCGGTAACAACATGTCCTTCCTGATCGCACTGGCGCTGA
CGGTGGTGATTTATCTGTGTGCTTATTTCATGCTGTTTATTGGCTACATTGTGTTGGTTCTTAAACATCCTGACTTAAAA
CGCACATTTAATATCCCTGGTGGTAAAGGGGTGAAACTGGTCGTGGCAATTGTCGGTCTGCTGACTTCAATTATGGCGTT
TATTGTTTCCTTCCTGCCGCCGGATAACATCCAGGGTGATTCTACCGATATGTATGTTGAATTACTGGTTGTTAGTTTCC
TGGTGGTACTTGCCCTGCCCTTTATTCTCTATGCTGTTCATGATCGTAAAGGCAAAGCAAATACCGGCGTCACTCTGGAG
CCAATCAACAGTCAGAACGCACCAAAAGGTCACTTCTTCCTGCACCCGCGTGCACGTTCACCACACTATATTGTGATGAA
TGACAAGAAACACTAA