Detailed information of Recipient susceptibility factor


Summary

ID RSF000010 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (467 a.a.); Nucleotide sequence (1401 bp)
Response to T6SS attack protective
Known or putative function Acid stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS07825 (gadB)
Coordinates (Strand) 1564902..1566302 (-)
NCBI ID 446281075
RefSeq NZ_CP009273
Uniprot ID A0A0E0XZM9_ECO1C, S1F7L6_ECOLX, A0A0A0FGI7_ECOLX, E3PLZ3_ECOH1, A7ZLU1_ECO24, B1LFC3_ECOSM, A0A140N806_ECOBD, A0A0H3PUR4_ECO5C, A5YKJ2_ECOLX, E8PU10_ECOLW, B7L7J2_ECO55, DCEB_SHIFL, A0A1X3LJ10_ECOLX, A0A0E1LX73_ECOLX, DCEB_ECOLI, DCEB_ECO57, I2UG61_ECOLX, I2WN58_ECOLX
KEGG ID ecw:EcE24377A_1682, ecj:JW1488, eck:EC55989_1625, elw:ECW_m1621, ecs:ECs2098, ecm:EcSMS35_1680, sfx:S1867, eco:b1493, esl:O3K_13030, elh:ETEC_1563, sfl:SF1734, ece:Z2215, ebd:ECBD_2146
PDB ID 1PMM, 1PMO, 2DGK, 2DGL, 2DGM, 3FZ6, 3FZ7, 3FZ8, 7JZH

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Pyridoxal_deC PF00282.21 1.7e-114 33..383

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-466 MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9872 - -



  Protein sequence: 467 a.a.    .

>RSF000010 NZ_CP009273:c1566302-1564902 [Escherichia coli BW25113]
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSI
NKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCG
PVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRP
AGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLR
LRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT*

  Nucleotide sequence: 1401 bp    .

>RSF000010 NZ_CP009273:c1566302-1564902 [Escherichia coli BW25113]
ATGGATAAGAAGCAAGTAACGGATTTAAGGTCGGAACTACTCGATTCACGTTTTGGTGCGAAGTCTATTTCCACTATCGC
AGAATCAAAACGTTTTCCGCTGCACGAAATGCGCGACGATGTCGCATTCCAGATTATCAATGACGAATTATATCTTGATG
GCAACGCTCGTCAGAACCTGGCCACTTTCTGCCAGACCTGGGACGACGAAAATGTCCACAAATTGATGGATTTATCCATT
AACAAAAACTGGATCGACAAAGAAGAATATCCGCAATCCGCAGCCATCGACCTGCGTTGCGTAAATATGGTTGCCGATCT
GTGGCATGCGCCTGCGCCGAAAAATGGTCAGGCCGTTGGCACCAACACCATTGGTTCTTCCGAGGCCTGTATGCTCGGCG
GGATGGCGATGAAATGGCGTTGGCGCAAGCGTATGGAAGCTGCAGGCAAACCAACGGATAAACCAAACCTGGTGTGCGGT
CCGGTACAAATCTGCTGGCATAAATTCGCCCGCTACTGGGATGTGGAGCTGCGTGAGATCCCTATGCGCCCCGGTCAGTT
GTTTATGGACCCGAAACGCATGATTGAAGCCTGTGACGAAAACACCATCGGCGTGGTGCCGACTTTCGGCGTGACCTACA
CTGGTAACTATGAGTTCCCACAACCGCTGCACGATGCGCTGGATAAATTCCAGGCCGATACCGGTATCGACATCGACATG
CACATCGACGCTGCCAGCGGTGGCTTCCTGGCACCGTTCGTCGCCCCGGATATCGTCTGGGACTTCCGCCTGCCGCGTGT
GAAATCGATCAGTGCTTCAGGCCATAAATTCGGTCTGGCTCCGCTGGGCTGCGGCTGGGTTATCTGGCGTGACGAAGAAG
CGCTGCCGCAGGAACTGGTGTTCAACGTTGACTACCTGGGTGGTCAAATTGGTACTTTTGCCATCAACTTCTCCCGCCCG
GCGGGTCAGGTAATTGCACAGTACTATGAATTCCTGCGCCTCGGTCGTGAAGGCTATACCAAAGTACAGAACGCCTCTTA
CCAGGTTGCCGCTTATCTGGCGGATGAAATCGCCAAACTGGGGCCGTATGAGTTCATCTGTACGGGTCGCCCGGACGAAG
GCATCCCGGCGGTTTGCTTCAAACTGAAAGATGGTGAAGATCCGGGATACACCCTGTATGACCTCTCTGAACGTCTGCGT
CTGCGCGGCTGGCAGGTTCCGGCCTTCACTCTCGGCGGTGAAGCCACCGACATCGTGGTGATGCGCATTATGTGTCGTCG
CGGCTTCGAAATGGACTTTGCTGAACTGTTGCTGGAAGACTACAAAGCCTCCCTGAAATATCTCAGCGATCACCCGAAAC
TGCAGGGTATTGCCCAACAGAACAGCTTTAAACATACCTGA