Detailed information of Recipient susceptibility factor


Summary

ID RSF000009 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (467 a.a.); Nucleotide sequence (1401 bp)
Response to T6SS attack protective
Known or putative function Acid stress response
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS18230 (gadA)
Coordinates (Strand) 3659540..3660940 (-)
NCBI ID 446294385
RefSeq NZ_CP009273
Uniprot ID S1EWP2_ECOLX, L3PXQ6_ECOLX, L4J052_ECOLX, A0A0A0FGY0_ECOLX, DCEA_ECOL6, A7ZT59_ECO24, A0A0E1T0N1_ECOLX, A0A140N3Z8_ECOBD, E8Q243_ECOLW, A0A169XS42_KLEOX, B7UL70_ECO27, B7L5Z8_ECO55, A0A2S8CZL0_SHIDY, A0A0I2HN64_SHISO, A0A1X3LD44_ECOLX, E9XSU5_ECOLX, E1IT64_ECOLX, D8E627_ECOLX, A0A0E1M4M5_ECOLX, D7XZB1_ECOM1, DCEA_ECOLI, I2UK13_ECOLX, I2X1Y3_ECOLX
KEGG ID ecg:E2348C_3759, eck:EC55989_3962, ecw:EcE24377A_4005, elw:ECW_m3780, ecc:c4328, ecj:JW3485, eco:b3517, ebd:ECBD_0222
PDB ID 1XEY

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Pyridoxal_deC PF00282.21 1.7e-114 33..383

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-466 MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9885 - -



  Protein sequence: 467 a.a.    .

>RSF000009 NZ_CP009273:c3660940-3659540 [Escherichia coli BW25113]
MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSI
NKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCG
PVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRP
AGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLR
LRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT*

  Nucleotide sequence: 1401 bp    .

>RSF000009 NZ_CP009273:c3660940-3659540 [Escherichia coli BW25113]
ATGGACCAGAAGCTGTTAACGGATTTCCGCTCAGAACTACTCGATTCACGTTTTGGCGCAAAGGCCATTTCTACTATCGC
GGAGTCAAAACGATTTCCGCTGCACGAAATGCGCGATGATGTCGCATTTCAGATTATCAATGATGAATTATATCTTGATG
GCAACGCTCGTCAGAACCTGGCCACTTTCTGCCAGACCTGGGACGACGAAAACGTCCATAAATTGATGGATTTGTCGATC
AATAAAAACTGGATCGACAAAGAAGAATATCCGCAATCCGCAGCCATCGACCTGCGTTGCGTAAATATGGTTGCCGATCT
GTGGCATGCGCCTGCGCCGAAAAATGGTCAGGCCGTTGGCACCAACACCATTGGTTCTTCCGAGGCCTGTATGCTCGGCG
GGATGGCGATGAAATGGCGTTGGCGCAAGCGTATGGAAGCTGCAGGCAAACCAACGGATAAACCAAACCTGGTGTGCGGT
CCGGTACAAATCTGCTGGCATAAATTCGCCCGCTACTGGGATGTGGAGCTGCGTGAGATCCCTATGCGCCCCGGTCAGTT
GTTTATGGACCCGAAACGCATGATTGAAGCCTGTGACGAAAACACCATCGGCGTGGTGCCGACTTTCGGCGTGACCTACA
CCGGTAACTATGAGTTCCCACAACCGCTGCACGATGCGCTGGATAAATTCCAGGCCGACACCGGTATCGACATCGACATG
CACATCGACGCTGCCAGCGGTGGCTTCCTGGCACCGTTCGTCGCCCCGGATATCGTCTGGGACTTCCGCCTGCCGCGTGT
GAAATCGATCAGTGCTTCAGGCCATAAATTCGGTCTGGCTCCGCTGGGCTGCGGCTGGGTTATCTGGCGTGACGAAGAAG
CGCTGCCGCAGGAACTGGTGTTCAACGTTGACTACCTGGGTGGTCAAATTGGTACTTTTGCCATCAACTTCTCCCGCCCG
GCGGGTCAGGTAATTGCACAGTACTATGAATTCCTGCGCCTCGGTCGTGAAGGCTATACCAAAGTACAGAACGCCTCTTA
CCAGGTTGCCGCTTATCTGGCGGATGAAATCGCCAAACTGGGGCCGTATGAGTTCATCTGTACGGGTCGCCCGGACGAAG
GCATCCCGGCGGTTTGCTTCAAACTGAAAGATGGTGAAGATCCGGGATACACCCTGTACGACCTCTCTGAACGTCTGCGT
CTGCGCGGCTGGCAGGTTCCGGCCTTCACTCTCGGCGGTGAAGCCACCGACATCGTGGTGATGCGCATTATGTGTCGTCG
CGGCTTCGAAATGGACTTTGCTGAACTGTTGCTGGAAGACTACAAAGCCTCCCTGAAATATCTCAGCGATCACCCGAAAC
TGCAGGGTATTGCCCAGCAGAACAGCTTTAAACACACCTGA