Detailed information of Recipient susceptibility factor


Summary

ID RSF000008 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (241 a.a.); Nucleotide sequence (723 bp)
Response to T6SS attack protective
Known or putative function envelope stress response
Description Deletion of the response regulators rcsB or baeR rendered E. coli sensitive to killing by V. cholerae TseH, significantly reducing survival. Complementation by exogenous expression of the deleted genes restored survival. These data indicate that the Rcs and BaeSR ESRs are critical for complete survival of E. coli against T6SS-delivered TseH
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS10855 (BaeR)
Coordinates (Strand) 2157757..2158479 (+)
NCBI ID 446060022
RefSeq NZ_CP009273
Uniprot ID K4XEW4_ECOLX, S1F3J2_ECOLX, V0SLQ3_ECOLX, U9ZTE1_ECOLX, V0VKC8_ECOLX, V0Z0P5_ECOLX, V0A455_ECOLX, A0A0E2L5A3_ECOU3, BAER_ECOL6, D3GZE3_ECO44, Q32EI3_SHIDS, E3PCM7_ECOH1, A0A0E1SUN8_ECOLX, Q1R9Z2_ECOUT, A0A0H2Z098_ECOK1, B1LNW2_ECOSM, A0A140N8R1_ECOBD, D6I9E7_ECOLX, D6JBX9_ECOLX, A0A181WNA6_KLEOX, B7UTB7_ECO27, B7ME91_ECO45, B7LV43_ESCF3, B7NCB5_ECOLU, B7MWZ2_ECO81, A0A1Q8M6V6_SHIBO, A0A2S8E2K2_SHIDY, A0A0I1VB19_SHISO, A0A1X3I5P4_ECOLX, F4T1E9_ECOLX, A0A1X3LZA0_ECOLX, A0A1X3IZT8_ECOLX, A0A0H3ELS6_ECO8N, A0A0E1M0U4_ECOLX, I4T4P8_ECOLX, BAER_ECOLI, I2X2N2_ECOLX, A0A192C904_ECOLX
KEGG ID ecm:EcSMS35_0981, ecv:APECO1_1169, ecz:ECS88_2178, ebd:ECBD_1574, sdy:SDY_2186, eln:NRG857_10565, elo:EC042_2318, eum:ECUMN_2417, ecc:c2605, ecg:E2348C_2222, ecj:JW2064, efe:EFER_2166, elh:ETEC_2222, ecq:ECED1_2425, eci:UTI89_C2354, eco:b2079
PDB ID 4B09

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.3e-24 13..121
Trans_reg_C PF00486.30 3.8e-23 157..231

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-240 MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRIV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9972 - -



  Protein sequence: 241 a.a.    .

>RSF000008 NZ_CP009273:2157757-2158479 [Escherichia coli BW25113]
MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFS
DIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRELQQQDAESPLIIDEGRFQASWRGKMLD
LTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRIV
*

  Nucleotide sequence: 723 bp    .

>RSF000008 NZ_CP009273:2157757-2158479 [Escherichia coli BW25113]
ATGACCGAGTTACCAATCGACGAAAACACACCGCGTATTTTGATCGTGGAAGATGAACCGAAGCTGGGGCAGTTGCTCAT
TGATTATCTGCGTGCTGCGAGCTATGCGCCGACGCTTATCAGCCACGGCGATCAGGTACTGCCGTATGTGCGCCAGACAC
CACCGGATCTGATCCTGTTAGATCTGATGCTCCCTGGCACCGATGGCCTGACGCTGTGCCGGGAAATTCGTCGTTTTTCT
GACATTCCGATCGTGATGGTGACGGCAAAAATCGAAGAGATCGATCGCCTGCTGGGGCTGGAGATTGGCGCAGATGATTA
TATCTGTAAGCCGTACAGCCCACGGGAAGTGGTAGCGCGCGTCAAAACCATTTTGCGCCGTTGCAAACCGCAGCGCGAGT
TGCAGCAACAGGATGCTGAAAGCCCGTTGATTATCGACGAAGGTCGTTTTCAGGCTTCATGGCGCGGTAAAATGCTTGAC
CTGACGCCTGCGGAATTTCGTCTGCTGAAAACGCTCTCTCACGAACCAGGAAAAGTGTTCTCCCGCGAGCAATTGCTCAA
TCATCTTTATGACGACTACCGCGTAGTAACCGACCGCACCATCGACAGCCACATTAAAAACCTGCGCCGCAAGCTGGAAT
CTCTCGACGCCGAACAGTCATTTATCCGCGCCGTTTATGGCGTCGGTTACCGCTGGGAAGCCGACGCCTGCCGCATCGTT
TAG