Detailed information of Recipient susceptibility factor


Summary

ID RSF000006 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (187 a.a.); Nucleotide sequence (561 bp)
Response to T6SS attack protective
Known or putative function Menbtane integrity
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS03235 (pagP)
Coordinates (Strand) 652013..652573 (+)
NCBI ID 447025838
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y404_ECO1C, K4XLI4_ECOLX, U9XMZ9_ECOLX, A7ZJ10_ECO24, A0A0E1T3R9_ECOLX, A0A140N9Q1_ECOBD, F4NLL8_ECOLX, B7L9L5_ECO55, A0A1X3JKJ6_ECOLX, A0A1X3L6C4_ECOLX, F4VB45_ECOLX, A0A1X3LN02_ECOLX, A0A1X3J599_ECOLX, E6BL31_ECOLX, E1IRC7_ECOLX, E1J1C8_ECOLX, D8E8U2_ECOLX, A0A0E1LWC4_ECOLX, D7XX81_ECOLX, PAGP_ECOLI, I2WRV0_ECOLX
KEGG ID eco:b0622, eck:EC55989_0615, ecw:EcE24377A_0647, ecj:JW0617, esl:O3K_18480, ebd:ECBD_3028
PDB ID 1MM4, 1MM5, 1THQ, 3GP6

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PagP PF07017.13 1.3e-67 37..183

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-186 MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9594 pos: 25-26. VFA-NA. MNVSKYVAIFSFVFIQLISVGKVFA



  Protein sequence: 187 a.a.    .

>RSF000006 NZ_CP009273:652013-652573 [Escherichia coli BW25113]
MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGF
GLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGP
VTFQMTYIPGTYNNGNVYFAWMRFQF*

  Nucleotide sequence: 561 bp    .

>RSF000006 NZ_CP009273:652013-652573 [Escherichia coli BW25113]
ATGAACGTGAGTAAATATGTCGCTATCTTTTCCTTTGTTTTTATTCAGTTAATCAGCGTTGGTAAAGTTTTTGCTAACGC
AGATGAGTGGATGACAACGTTTAGAGAAAATATTGCACAAACCTGGCAACAGCCTGAACATTATGATTTATATATTCCTG
CCATCACCTGGCATGCACGTTTCGCTTACGACAAAGAAAAAACCGATCGCTATAACGAGCGACCGTGGGGTGGCGGTTTT
GGCCTGTCGCGTTGGGATGAAAAAGGAAACTGGCATGGCCTGTATGCCATGGCATTTAAGGACTCGTGGAACAAATGGGA
ACCGATTGCCGGATACGGATGGGAAAGTACCTGGCGACCGCTGGCGGATGAAAATTTTCATTTAGGTCTGGGATTCACCG
CTGGCGTAACGGCACGCGATAACTGGAATTACATCCCTCTCCCGGTTCTACTGCCATTGGCCTCCGTGGGTTATGGCCCA
GTGACTTTTCAGATGACCTACATTCCGGGTACCTACAACAATGGCAATGTGTACTTTGCCTGGATGCGCTTTCAGTTTTG
A