Detailed information of Recipient susceptibility factor


Summary

ID RSF000005 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (429 a.a.); Nucleotide sequence (1287 bp)
Response to T6SS attack protective
Known or putative function Menbtane integrity
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS00275 (surA)
Coordinates (Strand) 53416..54702 (-)
NCBI ID 446723144
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y5D8_ECO1C, K4XH30_ECOLX, S1PDG9_ECOLX, S1EM39_ECOLX, L3QFS1_ECOLX, L4JGM4_ECOLX, U9XQ47_ECOLX, V0SZ92_ECOLX, U9ZZJ3_ECOLX, V0UV31_ECOLX, V0X9E8_ECOLX, U9ZIS0_ECOLX, A0A0E2LP33_ECOU3, A0A080JJN4_ECOLX, A0A0A0F5M7_ECOLX, SURA_ECOL6, D3H437_ECO44, E3PCA7_ECOH1, A7ZHE6_ECO24, A0A0E1SW79_ECOLX, SURA_ECOUT, A0A0H2YVI7_ECOK1, B1LFY9_ECOSM, A0A140NFR6_ECOBD, A0A0H3PZ73_ECO5C, D6II16_ECOLX, D6J5R7_ECOLX, F4NLC7_ECOLX, C3TR42_ECOLX, E0IYX3_ECOLW, A0A181WTL3_KLEOX, B7UIA1_ECO27, B7MAH8_ECO45, B7L4H6_ECO55, B7N7S8_ECOLU, A0A0H3MD09_ECO7I, B7MNR2_ECO81, A0A237FVM1_SHIBO, A0A1Q8NQ11_SHIDY, SURA_SHIFL, A0A0I2ZLB4_SHISO, A0A1X3JNA7_ECOLX, A0A1X3ICI8_ECOLX, A0A0K9THR6_ECOLX, F4STJ9_ECOLX, A0A1X3M397_ECOLX, E1ISV4_ECOLX, A0A0H3EFC5_ECO8N, A0A0E1LUW6_ECOLX, D7Y6U1_ECOM1, E9TIK5_ECOLX, I4T5T9_ECOLX, SURA_ECOLI, SURA_ECO57, I2WQ40_ECOLX, A0A192CI25_ECOLX
KEGG ID eln:NRG857_00285, ecm:EcSMS35_0057, ecg:E2348C_0056, sfx:S0052, ece:Z0062, elw:ECW_m0053, ecz:ECS88_0058, ecv:APECO1_1929, elo:EC042_0057, eum:ECUMN_0055, sfl:SF0050, elh:ETEC_0053, eco:b0053, ecc:c0066, ecj:JW0052, ect:ECIAI39_0056, ecw:EcE24377A_0057, eck:EC55989_0053, ebd:ECBD_3562, ecs:ECs0058, eci:UTI89_C0060, ecq:ECED1_0054, esl:O3K_21280
PDB ID 2PV1, 1M5Y, 2PV2, 2PV3

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
SurA_N PF09312.13 2.2e-46 25..142
Rotamase_3 PF13616.8 1.4e-26 281..383
Rotamase PF00639.23 5.8e-21 178..272

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-428 MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRASAYVKILSN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.9973 pos: 20-21. SFA-AP. MKNWKTLLLGIAMIANTSFA



  Protein sequence: 429 a.a.    .

>RSF000005 NZ_CP009273:c54702-53416 [Escherichia coli BW25113]
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQII
LQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESL
AQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELP
GIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTT
FAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRM
LMNRKFSEEAASWMQEQRASAYVKILSN*

  Nucleotide sequence: 1287 bp    .

>RSF000005 NZ_CP009273:c54702-53416 [Escherichia coli BW25113]
ATGAAGAACTGGAAAACGCTGCTTCTCGGTATCGCCATGATCGCGAATACCAGTTTCGCTGCCCCCCAGGTAGTCGATAA
AGTCGCAGCCGTCGTCAATAACGGCGTCGTGCTGGAAAGCGACGTTGATGGATTAATGCAGTCGGTAAAACTGAACGCTG
CTCAGGCAAGGCAGCAACTTCCTGATGACGCGACGCTGCGCCACCAAATCATGGAACGTTTGATCATGGATCAAATCATC
CTGCAGATGGGGCAGAAAATGGGAGTGAAAATCTCCGATGAGCAGCTGGATCAGGCGATTGCTAACATCGCGAAACAGAA
CAACATGACGCTGGATCAGATGCGCAGCCGTCTGGCTTACGATGGACTGAACTACAACACCTATCGTAACCAGATCCGCA
AAGAGATGATTATCTCTGAAGTGCGTAACAACGAGGTGCGTCGTCGCATCACCATCCTGCCGCAGGAAGTCGAATCCCTG
GCGCAGCAGGTGGGTAACCAAAACGACGCCAGCACTGAGCTGAACCTGAGCCACATCCTGATCCCGCTGCCGGAAAACCC
GACCTCTGATCAGGTGAACGAAGCGGAAAGCCAGGCGCGCGCCATTGTCGATCAGGCGCGTAACGGCGCTGATTTCGGTA
AGCTGGCGATTGCTCATTCTGCCGACCAGCAGGCGCTGAACGGCGGCCAGATGGGCTGGGGCCGTATTCAGGAGTTGCCC
GGGATCTTCGCCCAGGCATTAAGCACCGCGAAGAAAGGCGACATTGTTGGCCCGATTCGTTCCGGCGTTGGCTTCCATAT
TCTGAAAGTTAACGACCTGCGCGGCGAAAGCAAAAATATCTCGGTGACCGAAGTTCATGCTCGCCATATTCTGCTGAAAC
CGTCGCCGATCATGACTGACGAACAGGCCCGTGTGAAACTGGAACAGATTGCTGCTGATATCAAGAGTGGTAAAACGACT
TTTGCTGCCGCAGCGAAAGAGTTCTCTCAGGATCCAGGCTCTGCTAACCAGGGCGGCGATCTCGGCTGGGCTACACCAGA
TATTTTCGATCCGGCCTTCCGTGACGCCCTGACTCGCCTGAACAAAGGTCAAATGAGTGCACCGGTTCACTCTTCATTCG
GCTGGCATTTAATCGAACTGCTGGATACCCGTAATGTCGATAAAACCGACGCTGCGCAGAAAGATCGTGCATACCGCATG
CTGATGAACCGTAAGTTCTCGGAAGAAGCAGCAAGCTGGATGCAGGAACAACGTGCCAGCGCCTACGTTAAAATCCTGAG
CAACTAA