Detailed information of Recipient susceptibility factor


Summary

ID RSF000003 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (135 a.a.); Nucleotide sequence (405 bp)
Response to T6SS attack protective
Known or putative function RcsB regulon; response envelope stress
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS00985 (RcsF)
Coordinates (Strand) 216078..216482 (-)
NCBI ID 447125073
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y3K7_ECO1C, K4XJM0_ECOLX, S1NN71_ECOLX, S1EKN7_ECOLX, L4JG83_ECOLX, A0A0E2L9W9_ECOU3, A0A0A0F9D2_ECOLX, RCSF_ECOL6, D3GRE2_ECO44, Q32JR1_SHIDS, E3PDE9_ECOH1, A7ZHT8_ECO24, A0A0E1SXR7_ECOLX, Q1RFZ2_ECOUT, A0A0H2YVY1_ECOK1, A0A140NBJ5_ECOBD, D6IGU0_ECOLX, D6J6J0_ECOLX, F4NQY8_ECOLX, E0IYI5_ECOLW, A0A181WTU9_KLEOX, B7UJ98_ECO27, B7MBH8_ECO45, B7LHA6_ECO55, B7N864_ECOLU, A0A0H3MEQ4_ECO7I, B7MP57_ECO81, A0A1Q8MK30_SHIBO, A0A2S8DES2_SHIDY, A0A1X3JN70_ECOLX, A0A1X3LBM0_ECOLX, A0A1X3KU34_ECOLX, A0A1X3ID71_ECOLX, A0A1X3L9C4_ECOLX, A0A1X3M3C8_ECOLX, A0A1X3J832_ECOLX, A0A0H3EF59_ECO8N, A0A0E1LV93_ECOLX, I4T663_ECOLX, RCSF_ECOLI, A0A192CJ28_ECOLX
KEGG ID ect:ECIAI39_0447, ecz:ECS88_0208, eci:UTI89_C0212, elw:ECW_m0193, ecq:ECED1_0203, sdy:SDY_0215, ecc:c0237, ecw:EcE24377A_0203, eum:ECUMN_0194, ecv:APECO1_1791, eco:b0196, elh:ETEC_0192, ebd:ECBD_3422, ecj:JW0192, ecg:E2348C_0202, eln:NRG857_01005, esl:O3K_20575, elo:EC042_0195, eck:EC55989_0194
PDB ID 6T1W, 2Y1B, 2L8Y

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RcsF PF16358.7 1.9e-51 27..132

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-134 MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9992 pos: 15-16. LSG-CS. MRALPICLVALMLSG



  Protein sequence: 135 a.a.    .

>RSF000003 NZ_CP009273:c216482-216078 [Escherichia coli BW25113]
MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQD
SPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK*

  Nucleotide sequence: 405 bp    .

>RSF000003 NZ_CP009273:c216482-216078 [Escherichia coli BW25113]
ATGCGTGCTTTACCGATCTGTTTAGTAGCACTCATGCTAAGCGGCTGTTCCATGTTAAGCAGATCCCCTGTCGAACCCGT
TCAAAGCACTGCACCCCAGCCGAAAGCGGAGCCTGCAAAACCGAAAGCGCCGCGCGCCACGCCGGTCCGAATTTATACCA
ATGCAGAAGAATTAGTCGGCAAACCGTTCCGCGATCTCGGTGAAGTCAGTGGCGACTCTTGCCAGGCCTCTAATCAGGAC
TCTCCGCCGAGCATTCCAACCGCACGTAAGCGGATGCAAATCAACGCCTCTAAAATGAAAGCCAATGCTGTATTACTGCA
TAGCTGCGAAGTCACCAGCGGTACGCCAGGCTGCTATCGTCAGGCTGTATGTATCGGTTCTGCGCTTAACATTACGGCGA
AATGA