Detailed information of Recipient susceptibility factor


Summary

ID RSF000002 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (950 a.a.); Nucleotide sequence (2850 bp)
Response to T6SS attack protective
Known or putative function RcsB regulon; response envelope stress
Description The mutants with more-pronounced lysis, and then, competition assays with serial plating confirmed their survival was significantly reduced by the TseL-active T6SS-dependent killer
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS11585 (RcsC)
Coordinates (Strand) 2310506..2313355 (-)
NCBI ID 446798755
RefSeq NZ_CP009273
Uniprot ID A0A069FEX4_ECOLX, A0A1X3JE98_ECOLX, A0A0E1LZF7_ECOLX, RCSC_ECOLI
KEGG ID eco:b2218, ecj:JW5917, ecj:JW5920
PDB ID 2AYX, 2AYY, 2AYZ

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
RcsC PF09456.12 1.5e-37 709..799
HATPase_c PF02518.28 7.9e-30 581..690
Response_reg PF00072.26 3e-29 827..936
HisKA PF00512.27 6.3e-16 469..533

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-19 MKYLASFRTTLKASRYMFR
Transmembrane helix 20-42 ALALVLWLLIAFSSVFYIVNALH
Inside 43-314 QRESEIRQEFNLSSDQAQRFIQRTSDVMKELKYIAENRLSAENGVLSPRGRETQADVPAFEPLFADSDCSAMSNTWRGSLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGLRDMPVERDTALKALHERINKYRNAPQDDSGSNLYWISEGPRPGVGYFYALTPVYLANRLQALLGVEQTIRMENFFLPGTLPMGVTILDENGHTLISLTGPESKIKGDPRWMQERSWFGYTEGFRELVLKKNLPPSSLSIVYSVPVDKVLERIRM
Transmembrane helix 315-334 LILNAILLNVLAGAALFTLA
Outside 335-949 RMYERRIFIPAESDALRLEEHEQFNRKIVASAPVGICILRTADGVNILSNELAHTYLNMLTHEDRQRLTQIICGQQVNFVDVLTSNNTNLQISFVHSRYRNENVAICVLVDVSSRVKMEESLQEMAQAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEPREFSPREVMNHITANYLPLVVRKQLGLYCFIEPDVPVALNGDPMRLQQVISNLLSNAIKFTDTGCIVLHVRADGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAICEKLISMMDGDISVDSEPGMGSQFTVRIPLYGAQYPQKKGVEGLSGKRCWLAVRNASLCQFLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHSVAAPHELPALLARIYLIEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRKSRDS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9693 - -



  Protein sequence: 950 a.a.    .

>RSF000002 NZ_CP009273:c2313355-2310506 [Escherichia coli BW25113]
MKYLASFRTTLKASRYMFRALALVLWLLIAFSSVFYIVNALHQRESEIRQEFNLSSDQAQRFIQRTSDVMKELKYIAENR
LSAENGVLSPRGRETQADVPAFEPLFADSDCSAMSNTWRGSLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGL
RDMPVERDTALKALHERINKYRNAPQDDSGSNLYWISEGPRPGVGYFYALTPVYLANRLQALLGVEQTIRMENFFLPGTL
PMGVTILDENGHTLISLTGPESKIKGDPRWMQERSWFGYTEGFRELVLKKNLPPSSLSIVYSVPVDKVLERIRMLILNAI
LLNVLAGAALFTLARMYERRIFIPAESDALRLEEHEQFNRKIVASAPVGICILRTADGVNILSNELAHTYLNMLTHEDRQ
RLTQIICGQQVNFVDVLTSNNTNLQISFVHSRYRNENVAICVLVDVSSRVKMEESLQEMAQAAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEPREFSPREVMNHITANYLPLV
VRKQLGLYCFIEPDVPVALNGDPMRLQQVISNLLSNAIKFTDTGCIVLHVRADGDYLSIRVRDTGVGIPAKEVVRLFDPF
FQVGTGVQRNFQGTGLGLAICEKLISMMDGDISVDSEPGMGSQFTVRIPLYGAQYPQKKGVEGLSGKRCWLAVRNASLCQ
FLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHSVAAPHELPALLARIYL
IEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPN
MDGYRLTQRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRKSRDS*

  Nucleotide sequence: 2850 bp    .

>RSF000002 NZ_CP009273:c2313355-2310506 [Escherichia coli BW25113]
TTGAAATACCTTGCTTCTTTTCGTACAACCCTGAAAGCCTCGCGCTACATGTTCAGAGCATTGGCGTTAGTGCTCTGGCT
GTTGATTGCTTTTTCATCCGTTTTTTACATCGTTAATGCGTTACATCAGCGAGAATCGGAAATTCGTCAGGAATTTAATC
TGAGTTCCGATCAGGCTCAGCGCTTTATTCAACGCACCTCTGATGTGATGAAAGAGCTGAAGTACATCGCCGAAAATCGC
TTATCGGCAGAAAACGGTGTGCTTTCCCCGCGTGGACGAGAAACGCAGGCGGATGTGCCTGCGTTTGAACCGCTGTTTGC
CGACTCCGATTGTTCCGCAATGAGTAACACCTGGCGAGGTTCTCTGGAGTCATTGGCGTGGTTTATGCGCTACTGGCGCG
ATAATTTTTCTGCGGCTTACGATCTAAACCGGGTATTTTTAATCGGCAGCGATAACCTCTGCATGGCCAATTTCGGTCTG
CGTGATATGCCAGTGGAACGCGATACCGCGTTGAAAGCTTTGCATGAACGCATCAATAAATATCGAAATGCACCACAAGA
TGATAGCGGCAGTAACCTCTACTGGATCAGCGAAGGTCCGCGCCCTGGCGTCGGGTATTTTTACGCGTTGACGCCAGTTT
ATCTGGCGAACCGGTTGCAGGCGCTTTTGGGTGTCGAGCAGACCATCCGGATGGAGAACTTTTTCTTACCGGGTACGTTG
CCGATGGGGGTTACCATTCTTGATGAAAATGGTCATACCCTGATTTCGCTTACCGGACCAGAAAGTAAAATTAAGGGCGA
TCCTCGCTGGATGCAGGAACGCTCCTGGTTTGGCTATACGGAAGGGTTCCGGGAGCTGGTGCTGAAGAAAAATCTGCCAC
CCTCATCGCTAAGCATCGTGTATTCGGTGCCGGTTGATAAGGTGCTGGAACGCATTCGCATGTTGATCCTTAACGCAATT
TTGCTGAATGTGCTTGCCGGAGCTGCATTGTTTACTCTCGCACGGATGTACGAGCGACGTATTTTCATTCCGGCGGAAAG
CGACGCCCTGCGACTGGAAGAACATGAGCAGTTCAATCGCAAGATTGTCGCCTCCGCGCCAGTGGGTATCTGCATTTTGC
GTACCGCTGATGGCGTCAATATTTTAAGTAACGAACTGGCGCATACCTATCTCAATATGCTTACGCATGAGGACCGCCAA
CGACTGACGCAAATTATCTGTGGGCAGCAGGTCAATTTTGTTGATGTCCTGACCAGCAACAATACCAATCTGCAAATCAG
CTTCGTCCATTCGCGCTATCGTAATGAAAACGTGGCCATTTGTGTGCTGGTGGATGTTTCTTCGCGCGTGAAGATGGAAG
AGTCGTTGCAGGAGATGGCACAAGCAGCGGAACAGGCGAGCCAGTCAAAATCGATGTTCCTTGCCACCGTCAGTCATGAG
CTGCGAACGCCGCTGTATGGCATTATCGGTAACCTGGATCTGTTGCAAACCAAAGAGTTACCGAAAGGCGTCGATCGGCT
GGTGACGGCAATGAACAACTCTTCCAGCCTGTTGTTGAAAATTATCAGCGATATTCTCGATTTCTCGAAGATTGAATCGG
AACAGTTGAAGATCGAACCGCGTGAGTTTTCACCGCGTGAAGTGATGAACCACATCACCGCCAACTATTTACCGCTGGTG
GTACGCAAGCAGTTAGGCTTGTACTGCTTTATTGAACCGGATGTGCCAGTGGCCTTAAATGGCGACCCGATGCGTTTACA
GCAGGTCATCTCCAACCTGTTGAGTAACGCCATAAAATTCACCGATACCGGCTGTATAGTTTTGCATGTTCGCGCGGATG
GCGATTATCTCTCTATCCGTGTTCGCGATACCGGCGTGGGGATACCGGCGAAAGAAGTGGTGCGCTTGTTTGATCCCTTC
TTCCAGGTCGGAACGGGCGTACAGCGTAATTTCCAGGGGACCGGTCTGGGTCTGGCGATTTGTGAAAAACTGATCAGCAT
GATGGACGGCGATATCTCGGTAGATTCAGAACCGGGAATGGGCAGCCAGTTTACCGTGCGTATTCCGTTGTACGGCGCTC
AGTACCCGCAGAAAAAAGGCGTGGAAGGGTTGAGTGGTAAACGCTGCTGGCTGGCGGTCCGCAATGCGTCGCTCTGTCAG
TTCCTGGAAACCAGTTTGCAGCGCAGCGGCATCGTCGTTACAACATACGAAGGGCAGGAACCGACTCCCGAAGATGTGTT
GATCACTGACGAGGTAGTGAGTAAAAAATGGCAGGGCAGAGCGGTAGTGACCTTCTGTCGTCGCCATATTGGTATTCCGC
TGGAGAAAGCGCCAGGGGAGTGGGTACACAGTGTGGCTGCTCCGCATGAGCTACCGGCATTGTTGGCGCGTATTTATTTG
ATCGAGATGGAGAGCGACGATCCTGCTAACGCTCTGCCGTCAACGGACAAAGCGGTCAGCGATAATGACGATATGATGAT
TCTGGTCGTGGATGATCATCCGATTAACCGGCGTTTGCTGGCAGATCAGTTGGGATCGTTGGGCTATCAATGTAAAACCG
CGAATGATGGCGTCGATGCGCTTAATGTACTTAGCAAGAATCATATTGATATCGTGCTTAGCGACGTCAACATGCCAAAT
ATGGATGGTTACCGCTTGACGCAACGCATTCGTCAGTTGGGACTGACGTTGCCGGTAATCGGAGTAACTGCTAATGCGTT
GGCTGAAGAGAAGCAGCGGTGTCTGGAGTCCGGTATGGACAGCTGCCTGTCGAAGCCGGTAACGCTGGATGTGATAAAAC
AGACGCTGACGTTATATGCCGAGAGGGTCAGGAAATCGCGGGATTCGTAG