Detailed information of Recipient susceptibility factor


Summary

ID RSF000001 experimental
Strain Escherichia coli BW25113 strain K-12
Replicon chromosome
Sequence Protein sequence (217 a.a.); Nucleotide sequence (651 bp)
Response to T6SS attack protective
Known or putative function RcsB regulon; response envelope stress
Description Deletion of the response regulators rcsB or baeR rendered E. coli sensitive to killing by V. cholerae TseH, significantly reducing survival. Complementation by exogenous expression of the deleted genes restored survival. These data indicate that the Rcs and BaeSR ESRs are critical for complete survival of E. coli against T6SS-delivered TseH
Reference
experimental Experimental investigation has been performed.

External database links

Locus tag (Gene) BW25113_RS11580 (RcsB/ymgA)
Coordinates (Strand) 2309656..2310306 (+)
NCBI ID 446984661
RefSeq NZ_CP009273
Uniprot ID A0A0E0Y073_ECO1C, K4Y299_ECOLX, S1PG98_ECOLX, S1F473_ECOLX, L3Q2N3_ECOLX, L4J632_ECOLX, A0A0F6RFA2_CITAM, U9YD36_ECOLX, U9YL55_ECOLX, V0SF26_ECOLX, U9Z989_ECOLX, V0UR83_ECOLX, V0XRY5_ECOLX, V0ZFU1_ECOLX, U9ZZ96_ECOLX, A0A0E2LJT6_ECOU3, A0A080IUV1_ECOLX, A0A0A0FDX6_ECOLX, RCSB_ECOL6, A0A2K9P6I0_9ENTR, D3H0Q7_ECO44, A8ADZ6_CITK8, Q32I20_SHIDS, E3PDR9_ECOH1, A7ZP39_ECO24, A0A2S4S3B2_CITAM, A0A0H2Z1B9_ECOK1, B1LKW4_ECOSM, A0A0H3PXI1_ECO5C, A0A078LB51_CITKO, D6IC33_ECOLX, D6JCB8_ECOLX, A0A0M3F799_ENTCL, RCSB_ECOLX, E0IY85_ECOLW, A0A181WN86_KLEOX, B7UFN1_ECO27, B7MFD0_ECO45, B7LAP1_ECO55, B7N5H9_ECOLU, A0A0H3MS51_ECO7I, B7MXP8_ECO81, A0A1Q8M5C2_SHIBO, A0A1S9K1N2_SHIDY, RCSB_SHIFL, A0A0I2FRE2_SHISO, A0A0K9TA32_ECOLX, A0A1X3LLE3_ECOLX, A0A1X3LZJ9_ECOLX, E9XL29_ECOLX, E6BKG3_ECOLX, E1IJN9_ECOLX, E1JDV8_ECOLX, D8E7Q5_ECOLX, A0A0H3EL51_ECO8N, A0A0E1M3W6_ECOLX, D8A5G4_ECOMS, D7XL34_ECOLX, D7Y4X8_ECOM1, E9T9C7_ECOLX, I4T573_ECOLX, RCSB_ECOLI, RCSB_ECO57, J9JEG3_ECO57, I2UP38_ECOLX, I2WNX7_ECOLX
KEGG ID elw:ECW_m2419, ecq:ECED1_2683, ect:ECIAI39_2355, cko:CKO_00553, ecv:APECO1_4342, cama:F384_11900, sfl:SF2301, ecg:E2348C_2362, sdy:SDY_0857, ecs:ECs3106, sfx:S2432, eum:ECUMN_2554, ecw:EcE24377A_2517, ecj:JW2205, ecz:ECS88_2366, eck:EC55989_2472, eco:b2217, ecc:c2760, ecm:EcSMS35_2366, eln:NRG857_11250, elh:ETEC_2351, elo:EC042_2458, caf:AL524_10995, esl:O3K_08360, ece:Z3476
PDB ID 5VXN, 5W43, 5I4C

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.4e-24 6..120
GerE PF00196.21 3.4e-12 151..201

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9975 - -



  Protein sequence: 217 a.a.    .

>RSF000001 NZ_CP009273:2309656-2310306 [Escherichia coli BW25113]
MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPS
LSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLR
LFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD*

  Nucleotide sequence: 651 bp    .

>RSF000001 NZ_CP009273:2309656-2310306 [Escherichia coli BW25113]
ATGAACAATATGAACGTAATTATTGCCGATGACCATCCGATAGTCTTGTTCGGTATTCGCAAATCACTTGAGCAAATTGA
GTGGGTGAATGTTGTCGGCGAATTTGAAGACTCTACAGCACTGATCAACAACCTGCCGAAACTGGATGCGCATGTGTTGA
TTACCGATCTCTCCATGCCTGGCGATAAGTACGGCGATGGCATTACCTTAATCAAGTACATCAAGCGCCATTTCCCAAGC
CTGTCGATCATTGTTCTGACTATGAACAACAACCCGGCGATTCTTAGTGCGGTATTGGATCTGGATATCGAAGGGATCGT
GCTGAAACAAGGTGCACCGACCGATCTGCCGAAAGCTCTCGCCGCGCTGCAGAAAGGGAAGAAATTTACCCCGGAAAGCG
TTTCTCGCCTGTTGGAAAAAATCAGTGCTGGTGGTTACGGTGACAAGCGTCTCTCGCCAAAAGAGAGTGAAGTTCTGCGC
CTGTTTGCGGAAGGCTTCCTGGTGACCGAGATCGCTAAAAAGCTGAACCGCAGTATTAAAACCATCAGTAGCCAGAAGAA
ATCTGCGATGATGAAGCTGGGTGTCGAGAACGATATCGCCCTGCTGAATTATCTCTCTTCAGTGACCTTAAGTCCGGCAG
ATAAAGACTAA