Detailed information of effector


Summary

Effector ID EFF01864 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS01245 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 15955
Replicon chromosome
Sequence Protein sequence (183 a.a.); Nucleotide sequence (549 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At15955_RS22930 (Tae4)
Coordinates (Strand) 2027347..2027895 (+)
NCBI ID 503526804
RefSeq NZ_CP032918
Uniprot ID F0LD95_AGRFH, A0A1S7T4A2_AGRFH, A0A1S7NCB1_AGRFH
KEGG ID agr:AGROH133_09361, atf:Ach5_45210
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-23 MTAVAAAGGEVLLGRAAAGVATR
Transmembrane helix 24-46 LGARAALGFLGPVGAAIGLAMLA
Outside 47-182 YEGYELYKMYNESHSEPADGEAGSCTGNCDSAKAEEQKKRQEELEDEAGVSQQTKGKTKHGEKDGGMAEAERDFDSLKPGKEKGIETQYGPGRTGELEDGSKVTVRPGSSDGRPTLQIRRPNGRQTEIRYNDGPGV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6301 - -



  Protein sequence: 183 a.a.    .

>EFF01864 NZ_CP032918:2027347-2027895 [Agrobacterium tumefaciens]
MTAVAAAGGEVLLGRAAAGVATRLGARAALGFLGPVGAAIGLAMLAYEGYELYKMYNESHSEPADGEAGSCTGNCDSAKA
EEQKKRQEELEDEAGVSQQTKGKTKHGEKDGGMAEAERDFDSLKPGKEKGIETQYGPGRTGELEDGSKVTVRPGSSDGRP
TLQIRRPNGRQTEIRYNDGPGV*

  Nucleotide sequence: 549 bp    .

>EFF01864 NZ_CP032918:2027347-2027895 [Agrobacterium tumefaciens]
ATGACTGCCGTGGCTGCTGCTGGCGGGGAGGTTCTGCTTGGCCGTGCGGCTGCAGGCGTGGCAACGAGGCTCGGTGCCCG
CGCCGCGCTCGGTTTTCTTGGGCCAGTTGGTGCAGCAATCGGCCTCGCCATGCTGGCCTATGAAGGTTACGAACTCTACA
AAATGTACAATGAGAGCCATTCTGAACCCGCCGATGGCGAGGCGGGAAGCTGCACTGGGAACTGCGATTCGGCAAAGGCG
GAAGAACAGAAGAAGCGGCAAGAGGAACTGGAGGATGAAGCGGGCGTCAGTCAACAGACAAAGGGTAAGACAAAACACGG
CGAAAAGGATGGCGGTATGGCGGAAGCCGAACGCGACTTCGATTCCTTGAAACCGGGCAAGGAGAAAGGTATCGAAACAC
AATACGGGCCGGGCCGCACGGGGGAACTGGAAGACGGCAGCAAGGTTACCGTCCGTCCGGGAAGCTCTGACGGTCGTCCG
ACGTTGCAAATACGTAGGCCAAACGGTCGTCAGACCGAGATACGCTATAATGACGGACCTGGGGTTTAA