Detailed information of effector


Summary

Effector ID EFF01862 experimental
Effector type Tae
Cognate immunity protein -
Related T6SS (Type) T6SS01244 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1460
Replicon chromosome
Sequence Protein sequence (523 a.a.); Nucleotide sequence (1569 bp)
Description Hcp and Tae were detected in the media fraction of each strain while Hcp was not detected in the media fractions of any of the ΔtssL mutants but could be detected in the media fractions of mutant strains complemented with their cognate tssL gene
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1460_RS28410 (Tae4)
Coordinates (Strand) 1466206..1467774 (+)
NCBI ID 1815605961
RefSeq NZ_CP032927
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 1.8e-32 35..141

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-522 MSIPRDNYIGEPQYPGTWTTGTPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAMVMRSCTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVLAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDPVRGSLRWQDGSDEGRVMSDASPEPFKEGEKYAYAGSAAAATTGAAQNSAQALRGGMPATRPTVPQTVPRGPGRVITPGPARAPQWYRTPPHRVVSDLAKVGRLARVGIWARRLNVIGILSSVLIPDSGANLSDVVPRDDQERRIKEMFDEGVDAGHDSWEMRDWAMEELRRHRQRVREEPESRPQALPQSETVRVSDRDEYRKKCQVDRYAKMKSVCGQYGMQAHHIVPDWTLRYGAREEADKRIPNMPSLNDGMAICVIGNARVEQTEHWGGHLADKAIENAGRNSTPPFTAPLHKVVQASAQAMISVRPDCAKEIMAALTTQYAGKNPFQLLRAKQYPPLPEETISALKSGAVEGATRKP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9785 - -



  Protein sequence: 523 a.a.    .

>EFF01862 NZ_CP032927:1466206-1467774 [Agrobacterium tumefaciens]
MSIPRDNYIGEPQYPGTWTTGTPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAM
VMRSCTTHVHGDAPGNRKGVKSGTVESICEPIGHADQVLAEGSHVIRHLDRFYMNSRNTQGEAIFVRSTQTYDPPKDDDP
VRGSLRWQDGSDEGRVMSDASPEPFKEGEKYAYAGSAAAATTGAAQNSAQALRGGMPATRPTVPQTVPRGPGRVITPGPA
RAPQWYRTPPHRVVSDLAKVGRLARVGIWARRLNVIGILSSVLIPDSGANLSDVVPRDDQERRIKEMFDEGVDAGHDSWE
MRDWAMEELRRHRQRVREEPESRPQALPQSETVRVSDRDEYRKKCQVDRYAKMKSVCGQYGMQAHHIVPDWTLRYGAREE
ADKRIPNMPSLNDGMAICVIGNARVEQTEHWGGHLADKAIENAGRNSTPPFTAPLHKVVQASAQAMISVRPDCAKEIMAA
LTTQYAGKNPFQLLRAKQYPPLPEETISALKSGAVEGATRKP*

  Nucleotide sequence: 1569 bp    .

>EFF01862 NZ_CP032927:1466206-1467774 [Agrobacterium tumefaciens]
ATGAGCATCCCCCGCGACAATTATATCGGAGAGCCCCAATATCCCGGCACATGGACGACGGGGACACCGCGTGAGGGACT
GCGTGACATCGATGAGGCGCGTATCGTCTCTTTGGCACCTGATGTATGCCTGACACCGGTTGGCTCGTCGGTGGTGCCTA
TTCCCTATCCGGTCGTGGATTTTTGCGGCCATGATAAAAACTATACGCCGTCTGTTCGGTTCACCGGCAAAAAGGCAATG
GTGATGCGTTCGTGTACGACACATGTGCACGGCGACGCGCCCGGTAACCGTAAGGGGGTAAAATCCGGCACGGTGGAAAG
CATCTGCGAACCCATCGGGCACGCTGATCAGGTGCTTGCTGAAGGCTCGCATGTCATTCGCCACCTCGATCGTTTTTATA
TGAACAGCAGGAATACCCAGGGTGAGGCGATCTTCGTCCGCAGCACGCAGACCTATGATCCTCCCAAGGATGATGATCCG
GTGCGGGGGTCGCTTAGATGGCAGGACGGGTCGGACGAAGGCCGGGTTATGAGCGATGCGTCGCCCGAGCCGTTTAAAGA
GGGTGAGAAATACGCTTATGCGGGATCGGCTGCCGCAGCGACGACTGGGGCAGCTCAAAACTCTGCGCAAGCACTTCGCG
GAGGAATGCCGGCGACAAGGCCGACTGTCCCCCAGACTGTTCCTCGTGGTCCGGGAAGGGTGATAACCCCGGGACCCGCC
CGAGCGCCTCAGTGGTATCGTACCCCGCCTCACAGGGTTGTGAGCGATCTTGCAAAAGTTGGCCGTCTCGCGAGGGTGGG
CATTTGGGCCCGCCGCCTAAATGTCATCGGGATATTATCAAGCGTCCTTATCCCCGATAGTGGTGCAAATCTGTCTGACG
TCGTCCCACGGGACGATCAGGAGCGGCGGATCAAAGAAATGTTCGACGAGGGTGTCGACGCCGGACATGACAGCTGGGAG
ATGCGGGATTGGGCGATGGAGGAGCTCCGTCGACATCGGCAGCGAGTGCGTGAGGAACCAGAAAGCCGGCCACAGGCATT
ACCCCAGAGCGAAACCGTACGTGTCTCCGATCGGGACGAATACCGCAAGAAGTGTCAGGTCGACCGTTACGCCAAGATGA
AGAGCGTCTGCGGTCAGTACGGCATGCAGGCTCACCATATAGTTCCGGACTGGACGCTTCGTTATGGCGCGAGAGAGGAG
GCCGATAAGCGCATTCCGAATATGCCCAGCCTTAATGATGGTATGGCTATATGTGTTATTGGGAATGCCCGGGTAGAGCA
AACCGAGCACTGGGGTGGTCATCTGGCGGACAAGGCGATCGAAAATGCGGGTAGAAATTCAACGCCACCTTTTACGGCAC
CCTTACATAAAGTAGTTCAGGCGTCAGCCCAGGCTATGATAAGCGTGAGGCCCGATTGTGCAAAAGAGATTATGGCAGCC
CTGACGACCCAATATGCTGGAAAAAATCCGTTCCAGCTTTTACGAGCTAAACAATATCCTCCCCTTCCTGAAGAAACCAT
ATCGGCTTTGAAGTCTGGAGCTGTTGAAGGAGCGACCAGAAAACCATGA