Detailed information of effector


Summary

Effector ID EFF01837 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PP_3089 (hcp1)
Coordinates (Strand) 3478061..3478579 (-)
NCBI ID 898330886
RefSeq NC_002947
Uniprot ID A0A2V4FJ48_9PSED
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.1e-40 6..145

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQSGEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9734 - -



  Protein sequence: 173 a.a.    .

>EFF01837 NC_002947:c3478579-3478061 [Pseudomonas putida KT2440]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAKLFEHCCTGKH
IAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQSGEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIV
GGWDRTANKVFA*

  Nucleotide sequence: 519 bp    .

>EFF01837 NC_002947:c3478579-3478061 [Pseudomonas putida KT2440]
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGCGAAGTACTGGATGAAAAACACAAGGACTGGATCGAAGT
GCTGGGCTACGAGTACGGCGCCACCCAGGCTACGTCGGCAACCGCCAGCTCCTCGGGCGGTGCGTCCTCCGAGCGCGTTG
CCCTGAGCGACTTCAAGATCCGCAAGGCAGTCGACAAGGCATCGGCCAAACTGTTCGAACACTGCTGCACCGGCAAGCAC
ATCGCCAAGCTGAAGCTGAACGTGAACCGTGCCGGTGGCGACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGT
GGTCTCTTCGGTCAAGTTTGTCGCCGGTGGCAACCAGAGTGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAAGAAA
TCAGCTTCAACTTTGCCCGCATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCCGGCGGCAACATCGTG
GGTGGCTGGGACCGCACCGCGAACAAAGTGTTTGCCTAA