Detailed information of effector


Summary

Effector ID EFF01517 experimental
Effector type DddA
Cognate immunity protein -
Related T6SS (Type) -
Strain Burkholderia cenocepacia J2315
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Description TecA deamidation of RhoA mediates B. cenocepacia-induced pyrin inflammasome activation
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BCAM1857 (TecA)
Coordinates (Strand) 2076087..2076566 (+)
NCBI ID 206563705
RefSeq NC_011001
Uniprot ID UPI00017BA05A
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 LQARQMDANGRAIVRKAAGRIRLQRPCKVDRIHPSGAQQPAVDRANPGAADRNRRMKDIAAAREADRGARRNARAPVPLIAGFEVEPRPPRLTGRIEQRIGRDQRVCTQQIADIGRGVVADAAGYVFVDVRHPEHQRLRVFLPFGDAGLGDMPA*LGQL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9464 - -



  Protein sequence: 160 a.a.    .

>EFF01517 NC_011001:2076087-2076566 [Burkholderia cenocepacia J2315]
LQARQMDANGRAIVRKAAGRIRLQRPCKVDRIHPSGAQQPAVDRANPGAADRNRRMKDIAAAREADRGARRNARAPVPLI
AGFEVEPRPPRLTGRIEQRIGRDQRVCTQQIADIGRGVVADAAGYVFVDVRHPEHQRLRVFLPFGDAGLGDMPA*LGQLH

  Nucleotide sequence: 480 bp    .

>EFF01517 NC_011001:2076087-2076566 [Burkholderia cenocepacia J2315]
CTACAGGCGCGACAGATGGACGCGAATGGTCGTGCGATCGTACGTAAAGCCGCCGGCCGGATCCGGCTGCAGCGCCCGTG
CAAGGTCGACCGGATTCATCCATCCGGCGCCCAGCAGCCCGCCGTTGATCGCGCGAATCCGGGTGCCGCCGACCGCAATC
GCCGCATGAAAGACATTGCCGCCGCGCGCGAAGCCGACCGCGGTGCCCGCCGGAATGCTCGCGCGCCCGTCCCACTGATC
GCCGGTTTCGAAGTTGAACCGCGTCCTCCACGATTGACCGGCCGTATCGAGCAGCGCATCGGGCGCGATCAGCGCGTCTG
CACGCAGCAGATAGCGGACATAGGCCGCGGCGTCGTAGCAGACGCCGCGGGATACGTATTCGTCGATGTTCGCCATCCCG
AACATCAGCGCCTGCGCGTGTTTTTGCCGTTCGGCGATGCCGGATTGGGCGACATGCCCGCCTAACTGGGTCAGCTGCAC