Detailed information of effector


Summary

Effector ID EFF00059 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00042 experimental (Type i1)
Strain Pseudomonas syringae pv. tomato str. DC3000
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PSPTO_RS28130
Coordinates (Strand) 6181106..6181624 (+)
NCBI ID 28872543
RefSeq NC_004578
Uniprot ID Q87U73_PSESM
KEGG ID pst:PSPTO_5435
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.8e-38 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MATPAYMSITGTKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFSHELIIPRDPQSGQPTGQRVHKPVKITKVFDKSSPLLLAALTSGERLTEITIQWYRTSAAGTQEHYYTTKLEDAIIVDIKDYMHNCQDPANAHFTHLEDVEFTYRKITWTHEVSGTSGSDDWRSPVAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7877 - -



  Protein sequence: 173 a.a.    .

>EFF00059 NC_004578:6181106-6181624 [Pseudomonas syringae pv. tomato str. DC3000]
MATPAYMSITGTKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFSHELIIPRDPQSGQPTGQRVHKPVKITKVFDKSSPL
LLAALTSGERLTEITIQWYRTSAAGTQEHYYTTKLEDAIIVDIKDYMHNCQDPANAHFTHLEDVEFTYRKITWTHEVSGT
SGSDDWRSPVAG*

  Nucleotide sequence: 519 bp    .

>EFF00059 NC_004578:6181106-6181624 [Pseudomonas syringae pv. tomato str. DC3000]
ATGGCTACGCCAGCGTACATGTCCATCACCGGCACCAAACAAGGCCTGATCACCGCCGGTGCCTTCACTGCTGACTCGGT
CGGCAACACCTACCAGGAAGGTCACGAAGACCAAGTGATGGTTCAGGGCTTCAGCCACGAACTCATCATCCCGCGTGACC
CGCAGTCGGGCCAACCTACCGGTCAGCGCGTCCACAAGCCGGTCAAGATCACCAAAGTGTTCGACAAGTCCTCGCCTCTG
CTGCTGGCAGCACTGACCTCTGGCGAGCGTCTGACCGAAATCACCATCCAGTGGTACCGCACCTCGGCTGCCGGCACTCA
AGAGCACTACTACACCACCAAGCTTGAAGACGCGATCATCGTTGACATCAAGGACTACATGCACAATTGCCAAGACCCGG
CGAACGCGCATTTCACCCATTTGGAAGACGTAGAATTCACCTACCGCAAAATCACTTGGACCCACGAAGTATCCGGTACT
TCGGGTTCCGATGACTGGCGTTCCCCGGTCGCTGGCTAA