Detailed information of component protein


Summary

Component ID T6CP015998
Component protein type TssF
T6SS ID (Type) T6SS01289 experimental (Type i1)
Strain Vibrio cholerae DL4211
Replicon chromosome
Sequence Protein sequence (590 a.a.); Nucleotide sequence (1770 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BLX44_RS02390
Coordinate (Strand) 73492..75261 (-)
NCBI ID 446111937
RefSeq NZ_MOLL01000005
Uniprot ID Q9KN55_VIBCH, A0A0X1L1S3_VIBCO, A0A0H3AGM9_VIBC3, A0A0K9UV54_VIBCL, A0A0H3Q6K7_VIBCL, C3LUD4_VIBCM, A0A023PSA3_VIBCL
KEGG ID vcq:EN18_04275, vcz:VAB027_919, vcm:VCM66_A0108, vco:VC0395_0028, vcx:VAA049_1798, vch:VC_A0110
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 3.6e-158 5..584

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-589 MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSIINMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEHTREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFSTVGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVRQDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRIYSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLELGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRALVDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASINSFHELVVVNISNQEKYSWGTQSGMQPLI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9926 - -



  Protein sequence: 590 a.a.    

>T6CP015998 NZ_MOLL01000005:c75261-73492 [Vibrio cholerae] [TssF]
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSIINMLWPNYLR
PIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEHTREATTIQISLRMLGDMTVG
DAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFSTVGFSSDQALLPYPKNVYDGYRILQEYLSFP
EAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVRQDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYP
AHYEIFSVDQVVGWQDTQSEGKRIRGEKRIYSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSM
GVDEAVSIKLTCTNRLLPLELGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSC
VLRAYDFRALVDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASI
NSFHELVVVNISNQEKYSWGTQSGMQPLI*

  Nucleotide sequence: 1770 bp    

>T6CP015998 NZ_MOLL01000005:c75261-73492 [Vibrio cholerae] [TssF]
ATGACGCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTTTAAAAGAGCAGGGGAAAGAATTTACCGAAATTCACCCTCA
GCTTTCGCGTTTTCTTCATGGCCGTACGACCGATCCTGACGTTGAGCGTCTTTTGGAAGGTTTTGCATTTCTTACCGCGC
GTTTGCGCGAAAAGGTGGAGGATGAGTTCCCTGAACTTACTCACTCCATCATTAACATGCTGTGGCCAAATTATCTGCGC
CCTATCCCGAGCATGAGTGTGGTGGCGTTTGAACCTGACAAAAGTGTCAGCGAGAAGCAAGTCATCCCACGTAATACCCA
ATTGGATAGCAAGCCAGTCTTTGGCACGGCGTGTCATTTCAACACTTGCCGTGATGTCGCGCTGTATCCGATGCAGTGTC
AAGGTGTTCATGCCGAACACACACGTGAAGCCACGACCATTCAGATCTCGTTGCGCATGCTGGGCGATATGACAGTAGGC
GACGCTAAGCTCGATACCGTACGTTTTTACTTAGGTGGTGATAAATACAGCTCGCAGACTCTCTATCTTTGGTTACACCA
TTATCTACAAAAAATGACCATTGAAGTGCAAGGTGTCGAGTTCGCACTGCCTGCTGATGCGTTTTCAACCGTTGGTTTCT
CAAGTGACCAAGCTTTGCTGCCTTATCCAAAGAATGTCTATGACGGTTATCGTATTTTGCAAGAGTACCTGTCGTTTCCT
GAAGCCTTTCACTTCTTTGATGTAAAAGGTTTTGCCAAAGCTTTACCGAAAGCGGTCAGCGGTGATTTCACCTTACGCAT
CCATTTTTCGAAAACATTGCCTGCTGATACACGAGTGCGTCAGGACAATTTTCAACTCTATTGCACACCGGTCATCAATC
TGTTTGAGCATGATGCCGATCCGATCGATTTGACTGGGCGTCGTTCAGAGTATCGAATCGTCCCGTCCAGTCGCTATCCT
GCCCACTATGAAATTTTCAGCGTGGATCAAGTGGTTGGTTGGCAAGATACCCAGTCAGAAGGCAAACGGATCCGCGGAGA
AAAGCGTATCTACTCTTCTTTTGAAAGCTTCCAACATGAAGTGGAACGGGTTCGTCATCGTCAAGCGCTTTACTATCGCA
CACGAGTCAAAGAGAGCATCCGGGGGGATGGTTTTGATTCATTTATCTCTTTTGTGCGCGGTGATGAAACCTTATCAATG
GGCGTAGATGAAGCCGTCTCAATCAAACTCACCTGCACCAATCGCTTGCTGCCATTGGAACTTGGGGTGGGGGATATTTG
TGTGGCGACCGACAGCTCACCCCCTTTTGCCACATTCAAAAATATTACGGTGCCTTCGCAGTCACTGCGCCCGGTTCTCG
ATGGCAGCTTACTGTGGACGCTGATCTCGAATCTATCGCTGAACTACCTATCACTGCTTTCAAAAGATGCACTGAGCTGT
GTGCTACGCGCTTACGATTTTCGCGCCTTGGTCGATAGGCAAGCTGAACGTGTCGCACGGATGCGCCTTGATGGCATAGT
CAAAATAGAATCTAAACCGGTTGATAAAATCCTACGTGGTTTGCCTGTGCGTGGTTTGCAATCGACGTTGTATGTCGATC
AAGCGGGATTTGGCTCGGAAGGTGATTTGTTCCTGTTTGGTACGGTACTCAGTCATTTCTTTGCACTTTACGCCAGCATC
AACTCATTTCACGAATTAGTCGTGGTTAACATCAGCAATCAAGAGAAGTACTCATGGGGCACACAGAGCGGAATGCAGCC
GTTGATCTGA