Detailed information of component protein


Summary

Component ID T6CP015995
Component protein type TssJ
T6SS ID (Type) T6SS01289 experimental (Type i1)
Strain Vibrio cholerae DL4211
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BLX44_RS02375
Coordinate (Strand) 70546..71022 (-)
NCBI ID 446968055
RefSeq NZ_MOLL01000005
Uniprot ID Q9KN52_VIBCH, A0A0X1L1T9_VIBCO, A0A0H3AEY5_VIBC3, D7HAU7_VIBCL, A0A0K9UWF9_VIBCL, A0A0H3Q3J5_VIBCL, C3LUD7_VIBCM, A0A2A1YU60_VIBCL
KEGG ID vcz:VAB027_916, vcm:VCM66_A0111, vch:VC_A0113, vco:VC0395_0025, vcq:EN18_04290, vcx:VAA049_1795
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 4.8e-29 30..145

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 VNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9993 pos: 16-17. LTA-CS. VNKVLWMLFALTVLTA



  Protein sequence: 159 a.a.    

>T6CP015995 NZ_MOLL01000005:c71022-70546 [Vibrio cholerae] [TssJ]
VNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSDYDQIKTDYKK
ALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE*

  Nucleotide sequence: 477 bp    

>T6CP015995 NZ_MOLL01000005:c71022-70546 [Vibrio cholerae] [TssJ]
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTGCTGACTGCGTGCAGTTCGTCGGATAAGTACGAGCCTGCGAA
AGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTGGGGTGAAGCGTCACCGATAG
AAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGACTACGACCAGATCAAAACCGATTATAAAAAA
GCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTACTGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGT
CGATGAGGAGACCAACTACATCGGCGTGATGGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGG
TGATCAATAAAGGGCGAGAGTATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA