Detailed information of component protein


Summary

Component ID T6CP015895
Component protein type TssH
T6SS ID (Type) T6SS01278 experimental (Type i1)
Strain Aliivibrio fischeri strain FQ-A001
Replicon chromosome
Sequence Protein sequence (889 a.a.); Nucleotide sequence (2667 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VFFQA001_RS15610
Coordinate (Strand) 355350..358016 (+)
NCBI ID 1597593415
RefSeq NZ_SJSX01000004
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 4.6e-44 622..787
AAA_lid_9 PF17871.3 2.6e-31 357..452
ClpB_D2-small PF10431.11 2.3e-14 793..868
AAA PF00004.31 8e-10 220..348
Clp_N PF02861.22 3.2e-05 24..73

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-888 MININLSSLIQRLHPITKVALEDAAALAVSERASEVQIEHFLLSLLERPNSDFDQLLAHFECSENLLRQAIKSTLENSHKSNGGKPVFSAMLIEWLQEAWLVSSLDLSETQIRSGALLLTLISNPLRYGQHGYSSLLENINPETLKRNFAELTSRSIESQVATSEQTHAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIIDILARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGEVPDCLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQLVKLDEPSTEQAALIIRGLRAVYEKSHNVYVRDDAITAAATLSDRYISGRQLPDKAIDVLDTACARVNISLNAIPAPIETLQQEIAALERELDALERDQLQQTGDRHALAAIPELKARMDEALEEQSILQHQWKKEQALINEMIELRAHLHDLTLGTPSTEEVDDENNQDKPACSQFTEEETRQAIHTCNEQLEAARGNSPLVHFEVGPDEISHVISDWTGIPMGKMLQDEAETTLNLVSSLTESIKGQPYAIEALAEGLQTAKAGLVNPDAPTGVFLLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVQQSKDIDANIVAEAIRPTLNNHFKPALLARMNVLPFLPLNDEAMTDIIIHKLNKVSKRLEKHHKLTLSYNDELVSFILANCRLAETGARNIDAVINRQLLPQLSTQLLAHDKDETHTQIVISIDEQGTLGYVFS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9951 - -



  Protein sequence: 889 a.a.    

>T6CP015895 NZ_SJSX01000004:355350-358016 [Aliivibrio fischeri] [TssH]
MININLSSLIQRLHPITKVALEDAAALAVSERASEVQIEHFLLSLLERPNSDFDQLLAHFECSENLLRQAIKSTLENSHK
SNGGKPVFSAMLIEWLQEAWLVSSLDLSETQIRSGALLLTLISNPLRYGQHGYSSLLENINPETLKRNFAELTSRSIESQ
VATSEQTHAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIIDILARRRKNNPIAVGEPGVGKTAVVEGLALKIVQ
GEVPDCLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALAR
GEVKTIAATTWSEYKKYFEKDPALARRFQLVKLDEPSTEQAALIIRGLRAVYEKSHNVYVRDDAITAAATLSDRYISGRQ
LPDKAIDVLDTACARVNISLNAIPAPIETLQQEIAALERELDALERDQLQQTGDRHALAAIPELKARMDEALEEQSILQH
QWKKEQALINEMIELRAHLHDLTLGTPSTEEVDDENNQDKPACSQFTEEETRQAIHTCNEQLEAARGNSPLVHFEVGPDE
ISHVISDWTGIPMGKMLQDEAETTLNLVSSLTESIKGQPYAIEALAEGLQTAKAGLVNPDAPTGVFLLVGPSGVGKTETA
RAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEKADPEVLNLFYQVFD
KGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVQQSKDIDANIVAEAIRPTLNNHFKPALLARMNVLPFLPLNDEAMTD
IIIHKLNKVSKRLEKHHKLTLSYNDELVSFILANCRLAETGARNIDAVINRQLLPQLSTQLLAHDKDETHTQIVISIDEQ
GTLGYVFS*

  Nucleotide sequence: 2667 bp    

>T6CP015895 NZ_SJSX01000004:355350-358016 [Aliivibrio fischeri] [TssH]
ATGATAAATATAAATCTCTCTTCTTTAATACAACGTCTACACCCTATTACAAAGGTAGCTCTTGAAGATGCAGCTGCATT
AGCTGTTTCTGAACGTGCATCTGAAGTACAAATCGAACACTTTTTATTAAGCTTGCTTGAACGCCCAAATAGCGATTTTG
ACCAACTACTCGCTCATTTTGAATGTTCTGAAAATTTATTGCGCCAAGCAATCAAATCAACGCTAGAAAACAGTCATAAA
AGCAATGGTGGCAAACCAGTATTTTCAGCAATGCTAATTGAATGGTTACAAGAAGCATGGTTAGTTTCATCACTTGACTT
ATCAGAAACTCAAATTCGCTCTGGTGCATTACTGCTTACATTAATTAGCAATCCATTAAGATATGGTCAACATGGTTACT
CTTCTCTGTTGGAGAACATCAATCCAGAAACTCTGAAACGTAACTTTGCTGAATTAACATCACGTTCAATTGAATCTCAA
GTCGCTACATCAGAACAAACTCATGCTCGCGAAGATGGCTCTGCATTAAGTAAATTCACGACAGACTTTACAGGCAAAGC
ACGTAAAGGGGAAATTGACCCTGTATTCTGTCGTGACCAAGAAATTCGACAAATCATTGATATCCTAGCGCGTCGACGTA
AAAACAACCCTATCGCGGTTGGTGAACCAGGCGTTGGTAAAACAGCCGTAGTTGAAGGTTTAGCACTTAAAATTGTTCAA
GGCGAAGTTCCTGATTGCTTAAAAGGTGTTGAGCTTTACGGTTTAGACATGGGATTGCTTCAAGCAGGCGCAAGTGTAAA
AGGTGAATTTGAAAAACGTCTAAACGCTGTGCTAGACGAAGTTAAGAATTCTCCAACACCGATTATTCTTTTTATTGATG
AAGCACATACGCTTGTTGGTGGCGGTAATCAAGCTGGTGGTAGTGATGCCGCTAACTTATTGAAACCTGCGCTTGCTCGC
GGTGAAGTAAAAACCATTGCAGCAACAACTTGGTCAGAGTATAAAAAATATTTTGAAAAAGATCCTGCTTTAGCACGTCG
ATTCCAATTAGTTAAACTGGATGAGCCATCAACTGAACAAGCAGCTTTAATCATTCGTGGCCTGCGCGCTGTTTATGAAA
AATCGCACAATGTTTATGTTCGTGATGATGCAATAACTGCTGCAGCAACCCTATCGGACCGTTATATTTCTGGTCGCCAA
CTACCAGATAAAGCCATTGATGTATTAGATACAGCATGTGCTCGTGTAAACATCAGTTTAAACGCCATTCCAGCACCAAT
CGAAACTTTACAACAAGAAATTGCAGCTCTAGAGCGTGAACTTGACGCATTAGAACGAGATCAGTTACAGCAAACAGGTG
ATCGCCATGCCCTTGCTGCAATTCCTGAATTAAAAGCTCGTATGGATGAAGCGCTGGAAGAACAATCAATACTTCAACAT
CAGTGGAAAAAAGAGCAAGCTCTAATTAATGAAATGATTGAGTTACGTGCACACTTGCATGATCTAACATTAGGTACACC
TTCTACTGAAGAAGTTGATGATGAAAATAACCAAGACAAACCTGCATGCTCTCAGTTTACAGAAGAAGAAACGCGTCAAG
CAATTCATACTTGTAACGAACAACTAGAGGCTGCTCGTGGTAATAGCCCTCTTGTTCACTTCGAGGTAGGTCCTGATGAA
ATCAGTCATGTTATTTCAGATTGGACAGGCATTCCTATGGGCAAAATGCTACAAGATGAAGCAGAAACAACATTAAATCT
AGTATCGTCATTAACTGAAAGCATCAAAGGTCAACCTTATGCTATTGAAGCTTTAGCTGAAGGATTACAAACAGCGAAAG
CTGGATTGGTTAATCCAGATGCGCCAACCGGTGTATTCTTACTTGTTGGCCCAAGTGGTGTTGGTAAAACTGAAACAGCA
CGAGCAATTGCAGATCAAATGTTTGGTGGCGAGCGCTTCATGACGACCATTAACATGTCAGAATTCCAAGAAAAACATAC
GGTTTCACGTTTAATTGGTTCACCTCCAGGTTATGTAGGTTATGGCGAAGGTGGCATGTTAACGGAAGCTGTGCGTCAAC
GTCCTTATTCTGTTGTTCTACTGGATGAAGTTGAAAAAGCAGATCCAGAAGTATTGAATTTATTCTACCAAGTATTCGAT
AAAGGCACATTAAATGACGGTGAAGGTCGAACTATCGACTTTAAGAACACCTTAATCATTATGACAAGTAACCTTGCAAC
TCATGAAATTGAATCTTTAGTACAACAATCGAAAGATATCGATGCAAATATTGTTGCAGAGGCCATTCGCCCGACGTTAA
ACAACCACTTTAAACCAGCATTACTAGCTCGTATGAACGTATTACCGTTCTTACCTCTAAATGATGAAGCAATGACTGAT
ATCATCATTCATAAGCTAAATAAAGTATCTAAACGCTTAGAGAAGCACCATAAGTTAACCCTAAGCTACAACGATGAGCT
AGTGTCATTCATTCTTGCTAATTGTCGACTTGCGGAAACTGGTGCGCGTAATATTGATGCTGTAATTAACCGTCAACTAT
TACCTCAACTTTCAACTCAATTATTAGCACACGATAAAGATGAGACACATACTCAAATCGTGATTTCAATTGATGAGCAA
GGAACACTAGGTTATGTCTTTAGCTAA