Detailed information of component protein


Summary

Component ID T6CP015889
Component protein type TssE
T6SS ID (Type) T6SS01278 experimental (Type i1)
Strain Aliivibrio fischeri strain FQ-A001
Replicon chromosome
Sequence Protein sequence (137 a.a.); Nucleotide sequence (411 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VFFQA001_RS15555
Coordinate (Strand) 342279..342689 (-)
NCBI ID 1597593408
RefSeq NZ_SJSX01000004
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 1.1e-16 29..115

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-136 MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHAGNAMIDNDYGLPDFNDVLSNNTNLVRNIQQNIKASIEKFEPRMRNVEVHYRNDNNNPLQLGFGIGGEVIHNGGKVPMAINIFMGVDGQFNV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9951 - -



  Protein sequence: 137 a.a.    

>T6CP015889 NZ_SJSX01000004:c342689-342279 [Aliivibrio fischeri] [TssE]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHAGNAMIDNDYGLPDFNDVLSNNTNLVRNIQQNIKAS
IEKFEPRMRNVEVHYRNDNNNPLQLGFGIGGEVIHNGGKVPMAINIFMGVDGQFNV*

  Nucleotide sequence: 411 bp    

>T6CP015889 NZ_SJSX01000004:c342689-342279 [Aliivibrio fischeri] [TssE]
ATGGAAAAAGGTTATCGATTACTTGAGCGAATCGAATTAGGTGAGCCTAAAAATTGTTACGAAAAAGTCGTTTCACATAA
ACATTTGATTGAATCTATTCATCTTCACCTTGCTGATTTACTTAATACTCATGCTGGAAATGCGATGATAGATAACGATT
ACGGATTACCTGATTTTAATGATGTGTTATCCAATAACACCAATTTAGTTCGTAATATTCAACAGAACATTAAAGCATCG
ATTGAAAAGTTTGAACCAAGAATGCGTAACGTTGAGGTTCACTATCGTAATGATAACAATAACCCACTTCAACTTGGCTT
TGGGATCGGTGGGGAAGTGATTCATAACGGTGGTAAAGTCCCAATGGCGATTAATATCTTTATGGGCGTCGACGGTCAAT
TTAATGTGTAG