Detailed information of component protein


Summary

Component ID T6CP015888
Component protein type TssF
T6SS ID (Type) T6SS01278 experimental (Type i1)
Strain Aliivibrio fischeri strain FQ-A001
Replicon chromosome
Sequence Protein sequence (583 a.a.); Nucleotide sequence (1749 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VFFQA001_RS15550
Coordinate (Strand) 340518..342266 (-)
NCBI ID 1027711027
RefSeq NZ_SJSX01000004
Uniprot ID UPI0007C430DB
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 2.3e-162 5..579

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-582 VSNSKYFQDELTYLKEAGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRVREKIDDELPELTQSLISLLWPHYMRSVPSMCISELVPHSGSVTEKIIVERGAEMASEQVEGTQCQFRTCYDVALYPLSIQQIEQNNSRTNSSLHLTIAANNGLELSRIKLDTLRFHLHGEQHITRSLYLWLFRYLEYVELDVGGGYKHRLRADQVVPVGFGDDEGILPYSKNSFSGYRLLQEYFSLPDKFMFFDLKGLEWLSGIPQRSTVKISFAFSRALPSEVIVKNKHFKLHCTPSVNLFEKDGDPIRLDHQLNEYKVRPQSANQEHYEVYSVESVESWSKAERCRKKLIEFESFEHQINQRDKRDFYKTKVSERVNGRGLERYISFHSHNNQVSELGSETVLMKLVCSNADLAERLSVGDIIYTTHKSPTYATFTNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDYQSRVDRQAHRASIHRLDGIKSATMSPTDRVFRGVAIRGVKFKVGMNSSYFVNEGDMYLLASILNEFIRLYSSINSFTELEVIDEHTGEMYDWPSLSGQQTIL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9954 - -



  Protein sequence: 583 a.a.    

>T6CP015888 NZ_SJSX01000004:c342266-340518 [Aliivibrio fischeri] [TssF]
VSNSKYFQDELTYLKEAGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRVREKIDDELPELTQSLISLLWPHYMR
SVPSMCISELVPHSGSVTEKIIVERGAEMASEQVEGTQCQFRTCYDVALYPLSIQQIEQNNSRTNSSLHLTIAANNGLEL
SRIKLDTLRFHLHGEQHITRSLYLWLFRYLEYVELDVGGGYKHRLRADQVVPVGFGDDEGILPYSKNSFSGYRLLQEYFS
LPDKFMFFDLKGLEWLSGIPQRSTVKISFAFSRALPSEVIVKNKHFKLHCTPSVNLFEKDGDPIRLDHQLNEYKVRPQSA
NQEHYEVYSVESVESWSKAERCRKKLIEFESFEHQINQRDKRDFYKTKVSERVNGRGLERYISFHSHNNQVSELGSETVL
MKLVCSNADLAERLSVGDIIYTTHKSPTYATFTNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDY
QSRVDRQAHRASIHRLDGIKSATMSPTDRVFRGVAIRGVKFKVGMNSSYFVNEGDMYLLASILNEFIRLYSSINSFTELE
VIDEHTGEMYDWPSLSGQQTIL*

  Nucleotide sequence: 1749 bp    

>T6CP015888 NZ_SJSX01000004:c342266-340518 [Aliivibrio fischeri] [TssF]
GTGAGCAATAGCAAATATTTTCAAGATGAGCTTACTTATCTAAAAGAAGCGGGCAGTGAATTCGCAAAATATCACCCTAA
ACTGACGCACTTTTTATCTGAAGGTACATTTGATCCTGATGTTGAACGCTTATTAGAAGGCTTTGCTTTTTTAACTGGTC
GTGTTCGTGAAAAAATTGATGATGAATTGCCAGAATTAACCCAATCACTTATTTCTCTTCTTTGGCCACATTACATGCGA
TCTGTGCCTTCAATGTGCATTAGTGAATTGGTTCCTCATTCAGGTAGTGTGACTGAAAAAATTATTGTTGAACGTGGTGC
AGAGATGGCAAGTGAGCAAGTGGAAGGGACTCAATGTCAGTTTCGAACTTGCTATGATGTTGCTTTATACCCGTTATCTA
TTCAACAAATAGAGCAGAACAACAGTAGAACTAACTCATCTCTACATTTGACGATTGCAGCGAACAATGGTTTAGAGCTA
TCAAGAATTAAATTAGATACATTACGATTTCACTTACATGGTGAGCAGCATATTACACGTAGCTTATATTTATGGCTTTT
TCGTTATTTAGAATATGTTGAATTAGATGTTGGTGGTGGATATAAGCACCGTTTGCGTGCAGACCAAGTCGTTCCTGTTG
GTTTTGGAGATGACGAAGGGATATTGCCATACAGTAAAAACTCTTTCTCAGGATATCGCTTACTGCAAGAATATTTTTCC
TTGCCTGATAAATTTATGTTTTTTGATTTAAAAGGACTTGAATGGTTAAGTGGTATCCCGCAAAGAAGTACAGTTAAGAT
CTCTTTTGCGTTTTCTAGAGCACTTCCGTCAGAAGTTATTGTTAAAAATAAACATTTTAAATTACATTGTACGCCTAGTG
TTAATTTATTTGAAAAAGATGGTGACCCTATTCGACTCGATCATCAACTAAATGAATACAAAGTGCGCCCACAAAGCGCA
AATCAAGAGCATTACGAAGTGTATTCTGTTGAGAGTGTTGAAAGCTGGAGTAAGGCAGAGCGTTGTCGTAAGAAATTAAT
TGAATTTGAATCTTTCGAGCATCAAATAAATCAAAGAGACAAGCGTGATTTTTATAAAACAAAAGTTAGTGAGCGCGTTA
ATGGGCGAGGGTTAGAGCGTTATATTTCATTTCATTCACATAATAATCAAGTCTCTGAACTAGGGTCAGAAACAGTATTA
ATGAAGTTAGTGTGTAGCAATGCTGACTTGGCAGAGCGTTTATCTGTTGGCGATATTATTTATACAACACACAAATCACC
GACTTATGCGACGTTTACAAATATAACGAAACCTACTCAATCCGTTAGCCCACAAGTTAATGGTGAACTTCAATGGCAGT
TGATTGCAAACATGTCTCTCAACTACTTATCATTAGCGAATATTGACGTACTCAAGGTTTTATTATCAACCTATGATTAT
CAATCGCGTGTAGATAGGCAAGCACATAGAGCTTCAATTCATCGTTTAGACGGTATTAAATCGGCCACGATGTCACCTAC
AGATCGTGTATTTAGAGGTGTTGCGATTCGAGGTGTGAAATTTAAAGTGGGAATGAATTCATCTTATTTTGTTAATGAAG
GGGATATGTATTTACTTGCGAGTATTTTAAATGAATTTATTCGTTTGTATTCCAGCATCAACTCATTTACTGAACTTGAA
GTGATAGATGAACATACTGGGGAAATGTATGACTGGCCAAGTTTAAGTGGGCAGCAAACTATATTATGA