Detailed information of component protein


Summary

Component ID T6CP015886
Component protein type TssM
T6SS ID (Type) T6SS01278 experimental (Type i1)
Strain Aliivibrio fischeri strain FQ-A001
Replicon chromosome
Sequence Protein sequence (1133 a.a.); Nucleotide sequence (3399 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VFFQA001_RS15535
Coordinate (Strand) 335568..338966 (+)
NCBI ID 1027725209
RefSeq NZ_SJSX01000004
Uniprot ID UPI0007C44595
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 1.8e-43 155..408
IcmF-related PF06761.14 1.7e-41 486..756
IcmF_C PF06744.14 3e-15 1004..1106

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-10 MIKNTLARTP
Transmembrane helix 11-33 FILSTVISAFFALLLVGVYYLWF
Outside 34-37 NQAD
Transmembrane helix 38-60 LRLLWGMLGVIFSIYAIFNLTLY
Inside 61-401 IKKRKSKSHQNIETEEDTLSMVLKPLLNKAGKKPVYLVLGNKGSGKNQFLNVSNAIKPMDKVKNVKNDFFEWSESDSAVYIKPNHRLTFQEISSNDSLLWDALINEVIKHKPRKPFAGCMLLIDFEFLIVHDDEQTDYTLNALLQRLESIKETTGATLPLYLIMTKLDKLEGFKEYIHFSPLKSSVEFLAIPLKDAKGAILDYFRDSYKNIVKVMESNALDSSSYTNNPDEKQTILAFPKQFELCEKEISRIIERLNELNQGTYSVDIREVFFSSSLQGGRKYNLLAKSCSNYFNLPIIASEHGQLTETPYFTRFLVDAKVLPESDYSAENQHYLKRIQQH
Transmembrane helix 402-424 SRIAFTASAILLTSGGYFLFQAL
Outside 425-1132 DSNLRVINQLIQVEDTDLADYHSKDFTAKLINAQKAISPTYSAWLSGNRALDEEMLTMNVSRLEPTTKIAYNALIAQIDEFLMPVISEGYENLLTKNQNSVSTSLPLLKGYLMLNDPSKRDIPYLKQQTFDVLSTLSNDSVTVENTMNYLDAYFRTQFAPIDINMDLVRATRRSLLAKSNVDLVYAQILDQAKSIDLDTLDIQRAVGFDFTNIFEKPTTESNLQISKVYTASGFSSFYRPHIDLLSKRVIADNWVLGLSQHIIPTDDEQKDFKSDVRKKYTDDYINYWRNALSELKIKNFSNIYDLNNAIDLISGPSSPMTTVLKQLYSNTQFSSTADITSLMDAKKDLKGALETATDAVKEIIEPDYVLMSRVEQAFTLLNQLQISETKNSPTPWDDIVASLNQVRTYVKDIADSPNVHQAALDAARARMNRAEADPLVRLKQIAQKSPEPVRSWLLDIVNQTWSVMIVEATKGIQTRWYSEVYSIFKATGLNRYPFNTSATEEISLEDFEQLFATGGVLDVFIKDNLAPFYDINLWTAKRVDGQIMYLSPQFLVQLKNYNIIRNTMINKSTNKVFIPFNAKVIDLDSSAIRANINFGSTIMSYYHGPSKVQELQWPPKGGDFEVKFTLQDVTDEGKQHTLSKNGQWAIYRLLGESTLSDITNTNFVSHINVSGRDISMLFTPLTQNNPFTFAELANFKLPEVINKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9936 - -



  Protein sequence: 1133 a.a.    

>T6CP015886 NZ_SJSX01000004:335568-338966 [Aliivibrio fischeri] [TssM]
MIKNTLARTPFILSTVISAFFALLLVGVYYLWFNQADLRLLWGMLGVIFSIYAIFNLTLYIKKRKSKSHQNIETEEDTLS
MVLKPLLNKAGKKPVYLVLGNKGSGKNQFLNVSNAIKPMDKVKNVKNDFFEWSESDSAVYIKPNHRLTFQEISSNDSLLW
DALINEVIKHKPRKPFAGCMLLIDFEFLIVHDDEQTDYTLNALLQRLESIKETTGATLPLYLIMTKLDKLEGFKEYIHFS
PLKSSVEFLAIPLKDAKGAILDYFRDSYKNIVKVMESNALDSSSYTNNPDEKQTILAFPKQFELCEKEISRIIERLNELN
QGTYSVDIREVFFSSSLQGGRKYNLLAKSCSNYFNLPIIASEHGQLTETPYFTRFLVDAKVLPESDYSAENQHYLKRIQQ
HSRIAFTASAILLTSGGYFLFQALDSNLRVINQLIQVEDTDLADYHSKDFTAKLINAQKAISPTYSAWLSGNRALDEEML
TMNVSRLEPTTKIAYNALIAQIDEFLMPVISEGYENLLTKNQNSVSTSLPLLKGYLMLNDPSKRDIPYLKQQTFDVLSTL
SNDSVTVENTMNYLDAYFRTQFAPIDINMDLVRATRRSLLAKSNVDLVYAQILDQAKSIDLDTLDIQRAVGFDFTNIFEK
PTTESNLQISKVYTASGFSSFYRPHIDLLSKRVIADNWVLGLSQHIIPTDDEQKDFKSDVRKKYTDDYINYWRNALSELK
IKNFSNIYDLNNAIDLISGPSSPMTTVLKQLYSNTQFSSTADITSLMDAKKDLKGALETATDAVKEIIEPDYVLMSRVEQ
AFTLLNQLQISETKNSPTPWDDIVASLNQVRTYVKDIADSPNVHQAALDAARARMNRAEADPLVRLKQIAQKSPEPVRSW
LLDIVNQTWSVMIVEATKGIQTRWYSEVYSIFKATGLNRYPFNTSATEEISLEDFEQLFATGGVLDVFIKDNLAPFYDIN
LWTAKRVDGQIMYLSPQFLVQLKNYNIIRNTMINKSTNKVFIPFNAKVIDLDSSAIRANINFGSTIMSYYHGPSKVQELQ
WPPKGGDFEVKFTLQDVTDEGKQHTLSKNGQWAIYRLLGESTLSDITNTNFVSHINVSGRDISMLFTPLTQNNPFTFAEL
ANFKLPEVINKK*

  Nucleotide sequence: 3399 bp    

>T6CP015886 NZ_SJSX01000004:335568-338966 [Aliivibrio fischeri] [TssM]
ATGATTAAAAATACTTTGGCTAGAACACCTTTCATTTTATCGACAGTAATTTCAGCATTTTTTGCATTACTTTTAGTTGG
TGTATATTACTTATGGTTCAATCAAGCAGACCTACGTTTATTATGGGGGATGCTTGGTGTCATTTTTTCCATCTACGCTA
TTTTTAACCTGACTCTTTACATAAAAAAACGTAAAAGCAAAAGCCATCAAAATATCGAAACAGAAGAAGATACACTATCT
ATGGTTTTAAAACCTCTGCTTAATAAAGCAGGAAAGAAACCAGTGTATCTTGTTCTTGGTAATAAAGGATCAGGTAAAAA
TCAATTCTTGAATGTTTCAAACGCCATTAAACCAATGGATAAAGTGAAAAACGTTAAAAATGATTTCTTTGAATGGTCAG
AATCCGATTCAGCTGTATACATCAAGCCTAACCATCGGCTAACTTTTCAAGAAATATCGAGTAATGATAGTTTGCTGTGG
GATGCTTTAATTAATGAAGTGATCAAACATAAACCTCGTAAGCCTTTTGCGGGCTGTATGTTATTAATTGATTTTGAATT
TTTAATCGTACATGACGATGAACAAACTGATTACACATTAAATGCCCTACTCCAAAGACTGGAATCTATAAAAGAAACGA
CAGGTGCAACATTACCTCTGTATCTTATTATGACTAAGTTAGATAAATTGGAAGGTTTTAAAGAATACATTCACTTCAGT
CCTCTTAAATCGAGCGTTGAGTTTTTAGCTATTCCACTAAAAGACGCGAAAGGTGCCATTTTAGATTATTTCCGTGACAG
CTATAAAAACATAGTGAAAGTAATGGAATCTAATGCCCTTGACTCATCGTCGTACACTAACAATCCTGATGAAAAACAGA
CAATTTTAGCTTTTCCTAAACAATTTGAACTATGTGAGAAAGAAATATCTCGCATTATCGAACGTTTGAATGAATTAAAT
CAAGGTACCTACTCCGTTGATATTCGTGAAGTGTTTTTTAGCTCTAGTTTACAAGGTGGCCGAAAATATAACCTATTAGC
TAAAAGTTGTAGCAACTATTTCAATTTACCGATTATTGCATCTGAGCATGGCCAATTAACTGAAACGCCTTATTTTACCC
GCTTCTTAGTAGACGCAAAGGTATTACCTGAGTCTGATTATTCTGCTGAAAACCAGCATTACCTAAAGCGTATTCAACAA
CATAGCCGTATCGCTTTTACTGCTTCAGCTATATTGCTTACTAGTGGCGGATATTTCTTATTCCAAGCACTTGATAGTAA
CTTACGAGTTATTAACCAATTAATTCAAGTTGAAGATACAGATCTTGCTGATTACCACAGCAAAGATTTTACTGCCAAAT
TAATCAATGCTCAAAAGGCCATTTCACCAACTTATTCAGCATGGTTAAGCGGTAATCGCGCTTTAGATGAAGAAATGTTG
ACCATGAACGTTAGCCGTTTAGAGCCTACAACAAAAATTGCATACAATGCCCTAATTGCGCAAATAGATGAATTTTTAAT
GCCTGTTATTTCTGAAGGTTATGAGAACTTATTAACTAAAAATCAAAATTCAGTATCTACGTCATTGCCCTTGTTAAAAG
GATATTTGATGCTGAATGATCCAAGCAAACGTGATATTCCCTATTTAAAGCAACAGACCTTTGATGTGTTATCAACACTA
AGTAATGACTCTGTTACAGTTGAAAATACCATGAATTACCTTGATGCGTACTTCAGAACTCAATTTGCTCCTATTGATAT
AAATATGGATCTCGTTCGTGCTACCCGTCGTAGTCTATTGGCAAAATCAAATGTTGATTTAGTCTATGCTCAAATTTTAG
ATCAAGCGAAAAGCATTGATTTAGATACGTTAGATATTCAAAGAGCCGTTGGTTTTGATTTTACTAATATATTTGAAAAA
CCAACTACCGAAAGTAACTTACAAATCAGCAAGGTATATACTGCATCTGGTTTTAGTTCATTCTATCGTCCGCACATTGA
TCTTTTGTCAAAACGTGTTATCGCGGATAACTGGGTACTTGGTTTATCTCAACATATAATCCCTACTGATGATGAGCAAA
AAGATTTTAAAAGTGATGTGCGTAAAAAATACACTGATGACTACATCAACTATTGGCGTAATGCACTAAGTGAATTAAAG
ATTAAAAACTTTTCAAACATTTACGACTTGAATAATGCAATCGACCTAATTTCTGGTCCATCATCTCCGATGACAACCGT
ATTAAAACAGCTGTATTCGAACACACAGTTTTCTTCAACGGCTGACATCACTTCTTTGATGGATGCAAAAAAAGATCTAA
AGGGTGCTTTAGAAACAGCTACAGATGCAGTTAAAGAGATTATAGAACCTGATTACGTTTTAATGTCTCGTGTAGAGCAA
GCCTTTACTTTGCTTAACCAGCTACAAATTAGTGAAACAAAAAACTCTCCTACACCATGGGATGATATTGTTGCTTCATT
AAACCAAGTAAGAACGTATGTAAAAGACATTGCTGATTCCCCCAATGTCCATCAGGCGGCACTCGACGCTGCTAGAGCTC
GAATGAATAGAGCAGAAGCAGACCCATTAGTGCGCTTGAAACAAATTGCACAGAAATCGCCAGAGCCCGTAAGAAGCTGG
CTATTAGATATAGTGAATCAAACATGGTCAGTCATGATTGTTGAAGCCACTAAAGGTATCCAAACACGTTGGTATAGTGA
AGTTTATAGTATTTTTAAGGCAACGGGGTTAAATCGTTACCCATTCAATACCTCAGCTACCGAAGAAATCTCTCTTGAAG
ATTTTGAACAATTATTTGCGACAGGTGGAGTACTCGATGTCTTTATTAAGGATAACTTAGCACCATTTTACGACATTAAT
TTGTGGACAGCTAAACGCGTTGATGGGCAGATAATGTACTTATCCCCTCAATTTTTAGTTCAATTAAAAAACTACAATAT
TATTCGTAACACGATGATCAACAAAAGCACAAATAAAGTATTTATTCCTTTTAATGCGAAGGTCATCGACTTAGATTCAA
GTGCCATTAGAGCTAATATTAACTTTGGCAGCACAATAATGAGCTACTACCATGGGCCAAGTAAGGTACAAGAACTTCAA
TGGCCACCAAAAGGCGGCGATTTTGAAGTTAAATTTACCCTACAAGACGTAACTGATGAAGGTAAGCAACACACCTTATC
TAAAAATGGTCAATGGGCTATATATCGCCTACTAGGCGAATCAACCTTATCTGACATTACAAATACAAATTTTGTAAGTC
ATATAAATGTGTCAGGACGTGACATCAGCATGCTATTTACGCCTTTGACACAAAATAACCCTTTTACTTTCGCTGAGCTT
GCAAACTTTAAGCTGCCAGAAGTAATCAACAAAAAATAA