Detailed information of component protein


Summary

Component ID T6CP015883
Component protein type TssJ
T6SS ID (Type) T6SS01278 experimental (Type i1)
Strain Aliivibrio fischeri strain FQ-A001
Replicon chromosome
Sequence Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VFFQA001_RS15475
Coordinate (Strand) 316834..317334 (+)
NCBI ID 501528638
RefSeq NZ_SJSX01000004
Uniprot ID B5EUI7_ALIFM
KEGG ID vfm:VFMJ11_A0806
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 4e-29 34..150

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-166 MRKLLTFSLIFLLSGCTMWDQFKESTGITPETSSIELIITADKVLNVREGGQSSPVILRIHELNSPVLFRNLDFFALFENDKDALGDEYIKRYEYQIQPGDVVHETLVLDPATRAIGFSVAFRDINGSSWRKVELIEEKSEYFLKLNLKESELSSNNTRGIEQIYF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9984 pos: 15-16. LSG-CT. MRKLLTFSLIFLLSG



  Protein sequence: 167 a.a.    

>T6CP015883 NZ_SJSX01000004:316834-317334 [Aliivibrio fischeri] [TssJ]
MRKLLTFSLIFLLSGCTMWDQFKESTGITPETSSIELIITADKVLNVREGGQSSPVILRIHELNSPVLFRNLDFFALFEN
DKDALGDEYIKRYEYQIQPGDVVHETLVLDPATRAIGFSVAFRDINGSSWRKVELIEEKSEYFLKLNLKESELSSNNTRG
IEQIYF*

  Nucleotide sequence: 501 bp    

>T6CP015883 NZ_SJSX01000004:316834-317334 [Aliivibrio fischeri] [TssJ]
ATGCGAAAATTACTCACGTTTTCTCTTATTTTTTTATTATCTGGCTGCACTATGTGGGATCAGTTTAAAGAATCAACAGG
AATTACCCCTGAAACCTCTTCTATCGAGTTAATTATTACAGCAGATAAAGTATTAAATGTTCGTGAAGGTGGACAATCAT
CCCCCGTAATATTGAGGATTCATGAACTAAACTCCCCTGTTCTTTTTCGTAACCTTGATTTCTTTGCGTTATTTGAAAAT
GACAAAGATGCACTTGGTGATGAGTATATAAAACGATACGAATACCAAATTCAGCCTGGGGATGTAGTACATGAGACTCT
GGTATTAGACCCAGCGACTCGAGCTATCGGTTTCTCTGTAGCATTTAGAGACATAAACGGATCATCTTGGCGTAAAGTCG
AGTTAATCGAAGAAAAAAGCGAATACTTCTTAAAGCTAAACCTGAAAGAAAGTGAACTTAGCTCCAACAATACTCGCGGT
ATTGAGCAAATATATTTTTAA