Detailed information of component protein


Summary

Component ID T6CP015408
Component protein type TssK
T6SS ID (Type) T6SS01218 experimental (Type i4b)
Strain Xanthomonas oryzae pv. oryzicola strain GX01
Replicon chromosome
Sequence Protein sequence (445 a.a.); Nucleotide sequence (1335 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) XOCgx_RS16500
Coordinate (Strand) 3514398..3515732 (+)
NCBI ID WP_011259947.1
RefSeq NZ_CP043403
Uniprot ID A0A7U4NBX0_9XANT, A0A411QI68_9XANT, G7TI15_XANOB, A0A346MBX7_XANOO
KEGG ID xor:XOC_1350
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 3.4e-140 16..442

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-444 MSKVFWGEGLFLRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGESYDAPAHDALPDALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQSELAYLSKAVKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAKVDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYVPSGIDDLKMELVAVTS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9894 - -



  Protein sequence: 445 a.a.    

>T6CP015408 NZ_CP043403:3514398-3515732 [Xanthomonas oryzae pv. oryzicola] [TssK]
MSKVFWGEGLFLRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGESYDAPAHDAL
PDALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQSELAYLSKAVKLLTDDTPRDP
YVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAKVDALYGLHRQSSQHIIEFRSGDIASFWLLH
TACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKI
ALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVR
PGSYYFALEARGPLYERMLKAQSMMLYVPSGIDDLKMELVAVTS*

  Nucleotide sequence: 1335 bp    

>T6CP015408 NZ_CP043403:3514398-3515732 [Xanthomonas oryzae pv. oryzicola] [TssK]
ATGTCGAAAGTATTTTGGGGCGAAGGGCTGTTTTTGCGGCCGCAGCATTTCCAGCGCCAGGACACCTACCACGAAGCAAG
GCTGCAGGATCTGGCGCAGACGCTGCATCCCTATGGCTGGGGAACGCGCCGGATCCGTTTCGATCCGCAGAGCATGGCCA
GCGGCAGCTTGCGCGCGCTCGCCCTGTCGGTGGTCTTTCCCGATGGCGAATCGTACGACGCGCCGGCGCACGACGCGCTG
CCCGATGCGCTGTCGCTGAATGACCTCCCCGCCGGCATCCAGACCACCACGGTGTACCTGGCGCTGCCGTTGCTGCGCGA
CGACGGCGGCAACTGTAGCGATGCGGAGGGTTCGCAACTGGCCCGCTACCAGCAGCTCAACCGGCCGACCAGCGACCTGT
ACACCGACGCGGCCCAATCGGAACTGGCGTACCTGAGCAAGGCGGTGAAGCTGCTCACCGACGACACTCCGCGCGATCCG
TACGTGACCGTGCCGGTGGCGCGCGTGCGCCGTACCCCGACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATG
CGCGCACATCGACGCCTCGCCGACGCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAGGTCGATGCGC
TGTACGGGCTGCATCGGCAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCGCCTCGTTCTGGCTGCTGCAT
ACCGCCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCAGCTGCACCCCGAGCGCCTGTACCAGGAACT
GCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCCTACCAGCTCAACGACCTGCCCCGGTACAACCACGCGGCAC
CGGAAGCCTGCTTCCAGCGCCTGTTCCAGATCGTGCGCGACCTGCTCGACACGGTGATCTCGGCGCGCTACTTCAAGATC
GCGCTGACCGAGGTCAAGCCGTCGTTCCACCTGGGCCGGATCGATTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCT
GAGCGTGTCGGCCGACATGCCCGGGCCGGAACTGGTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACG
TCGAGAAGTGCGTGCTGTCGGCCCTGCCGGGCGTGAAACTGACCCACGCCGCGCAGGTGCCGGCAGCGATCCCGGTCCGT
CCCGGCAGCTACTATTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAGGCGCAGTCTATGATGCTCTA
TGTGCCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTGACCTCATGA