Detailed information of component protein


Summary

Component ID T6CP015407
Component protein type TssJ
T6SS ID (Type) T6SS01218 experimental (Type i4b)
Strain Xanthomonas oryzae pv. oryzicola strain GX01
Replicon chromosome
Sequence Protein sequence (203 a.a.); Nucleotide sequence (609 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) XOCgx_RS16495
Coordinate (Strand) 3513638..3514246 (+)
NCBI ID WP_044750743.1
RefSeq NZ_CP043403
Uniprot ID A0A0C5VDX9_9XANT, A0A5E8KUP9_9XANT
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 9e-26 53..171

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MNTSAH
Transmembrane helix 7-29 RFNFLLVLVVAALALSGCASGGI
Outside 30-202 GKAMDKTLQAVGIKEAKPEASPMIPLRLLAGSNLNAGNDTHATAAVVKIYHLRSAQRFEQATFNAFLDQAGEQAALGADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVALFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASPALVTRLAGDPSSLASVRCAAAR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9966 pos: 23-24. LSG-CA. MNTSAHRFNFLLVLVVAALALSG



  Protein sequence: 203 a.a.    

>T6CP015407 NZ_CP043403:3513638-3514246 [Xanthomonas oryzae pv. oryzicola] [TssJ]
MNTSAHRFNFLLVLVVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPMIPLRLLAGSNLNAGNDTHATAAVVKIYH
LRSAQRFEQATFNAFLDQAGEQAALGADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVALFRAPAEGRWRMAFDTRRKE
LPTQGITIGIHACALTTASPALVTRLAGDPSSLASVRCAAAR*

  Nucleotide sequence: 609 bp    

>T6CP015407 NZ_CP043403:3513638-3514246 [Xanthomonas oryzae pv. oryzicola] [TssJ]
ATGAACACATCCGCCCACCGTTTCAATTTTCTGTTGGTCCTTGTTGTGGCCGCGCTAGCCCTGTCCGGCTGCGCCAGCGG
CGGCATCGGCAAGGCGATGGACAAGACCCTGCAGGCAGTGGGCATCAAGGAAGCAAAGCCAGAGGCGTCTCCGATGATTC
CCCTGCGGCTGCTTGCCGGCAGCAACCTGAATGCGGGCAACGACACGCACGCCACCGCAGCGGTGGTCAAGATCTATCAC
CTGCGCAGCGCGCAACGCTTCGAGCAGGCCACGTTCAACGCGTTCCTCGATCAGGCCGGAGAGCAGGCGGCGCTGGGCGC
GGACCTGCTGTCGGTCAACGAGATCGTTCTGACGCCAAGCGCCCGCCAGGAACTGAACGAGCAGATGTCCGAAGGCACCA
CCACCCTGGGCGTGGTGGCCTTGTTCCGCGCGCCGGCCGAGGGCCGCTGGCGCATGGCCTTCGATACGCGACGCAAGGAA
TTGCCGACCCAGGGCATCACCATCGGCATTCACGCCTGCGCGCTGACCACCGCAAGCCCGGCGCTGGTCACCCGCCTGGC
GGGCGATCCCAGCAGCCTGGCGTCGGTGCGTTGCGCCGCTGCGCGCTAG