Detailed information of component protein


Summary

Component ID T6CP015406
Component protein type TssB
T6SS ID (Type) T6SS01218 experimental (Type i4b)
Strain Xanthomonas oryzae pv. oryzicola strain GX01
Replicon chromosome
Sequence Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) XOCgx_RS16485
Coordinate (Strand) 3512216..3512716 (-)
NCBI ID WP_003467601.1
RefSeq NZ_CP043403
Uniprot ID A0A0C5V208_9XANT, A0A1M4IKG8_XANCT, A0A514ECX6_XANCT, A0A411QU45_9XANT, G7TI18_XANOB, A0A0G3LUN6_XANCT, A0A1C3NS62_9XANT, A0A365S229_XANOO
KEGG ID xor:XOC_1353, xtn:FD63_13815
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 8.3e-61 12..163

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-166 MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNFDEVMEGMAPRAVYRVPNKISDAGGEFGVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGNEKLEDLLTDVLNNTEQLKKLGREKEK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9959 - -



  Protein sequence: 167 a.a.    

>T6CP015406 NZ_CP043403:c3512716-3512216 [Xanthomonas oryzae pv. oryzicola] [TssB]
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNFDEVMEGMAPR
AVYRVPNKISDAGGEFGVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGNEKLEDLLTDVLNNTEQLKKL
GREKEK*

  Nucleotide sequence: 501 bp    

>T6CP015406 NZ_CP043403:c3512716-3512216 [Xanthomonas oryzae pv. oryzicola] [TssB]
ATGGCTAAGAAGGAAAGCATCCAGAAACGTCTGCAGAAGATTCGGCCGCCGCGCGTGCAGCTGACCTACGACGTGGAAAA
GGGTGACGCGATCGAACAGAAGGAGCTGCCGTTCGTGGTAGGCGTGCTTGGGGATTTCAGCGGCAATCCCGAACAGCCCC
TGGCCAAGGTCAAGGACCGCAAATTCGTCAACGTCGACCTCGACAACTTCGACGAGGTGATGGAGGGAATGGCGCCGCGC
GCGGTTTACCGCGTGCCGAACAAGATCAGCGATGCCGGCGGCGAGTTCGGCGTCGAACTCAAGTTCAAGTCGATCGACGA
CTTCCGTCCGGAGGCTGTGGTCGATCAGGTCGAACCGCTGCGCAAGCTGCTAGAATCGCGCACCAAGCTGGCAGACCTGC
GCAACAAGCTGGCCGGCAACGAGAAGCTCGAAGACCTGCTAACGGACGTGTTGAACAACACCGAACAGCTGAAGAAGCTG
GGTCGGGAAAAGGAGAAGTAA