Detailed information of component protein


Summary

Component ID T6CP015405
Component protein type TssC
T6SS ID (Type) T6SS01218 experimental (Type i4b)
Strain Xanthomonas oryzae pv. oryzicola strain GX01
Replicon chromosome
Sequence Protein sequence (499 a.a.); Nucleotide sequence (1497 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) XOCgx_RS16480
Coordinate (Strand) 3510716..3512212 (-)
NCBI ID WP_014502419.1
RefSeq NZ_CP043403
Uniprot ID A0A0C5V2D4_9XANT, A0A5E8KUP5_9XANT, G7TI19_XANOB
KEGG ID xor:XOC_1354
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 5.4e-139 69..371
VipB_2 PF18945.2 3.1e-47 381..491

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-498 MVAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDARIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQSALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWCNTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAAFFGAQSAQKPKKYNTNAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARNVEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDELSVSLRLVAELPAGTKKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8932 - -



  Protein sequence: 499 a.a.    

>T6CP015405 NZ_CP043403:c3512212-3510716 [Xanthomonas oryzae pv. oryzicola] [TssC]
MVAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDARIAEIDRIIS
EQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQSALFKKVYEEEFGTFGGAPFG
ALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVG
LTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWCNTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTF
RTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAAFFGAQSAQKPKKYNTNAANANAILSAQLQYMFAVSRI
AHYLKAMMREKIGSFASARNVEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDE
LSVSLRLVAELPAGTKKA*

  Nucleotide sequence: 1497 bp    

>T6CP015405 NZ_CP043403:c3512212-3510716 [Xanthomonas oryzae pv. oryzicola] [TssC]
ATGGTCGCAGAGGTTTCGAGTGCCACCCACAATTCGGCGCCCGCCGCGCTGGCAGAAACAGGCTTGCTCGACCAGATCGT
CGAGCAGAGCAAGGTCGCCAAATCGGAGACCGAGCACCAGCGTGCGAAGGACATCATCTCCGAGCTGGCCAAGGAGGTGC
TGGAAGGTACCGTCGTGGTGTCGGACAACCTCAATCTGACGCTGGACGCGCGCATTGCCGAGATCGACCGGATCATCTCC
GAGCAGCTGAGCGCGGTGATGCATGCGCCGGAGTTCCAGAAGCTGGAGAGCAGCTGGCGCGGCCTGCACTACATGTGCGA
GCAGACGTCCACCGGCGTGACGATGAAGATCAAGGTCTTCAACTCGCCCCAGCGGGATCTGGTGCGCGACTTCAAGTCGG
CGATCGACTTCGATCAAAGCGCGCTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGTGCGCCATTCGGC
GCATTGGTCGGCGACTACTACATCGGCCGCCAGCCGGAGGACATGTACTTCGTCGAGCAGATGTCGCATGTGGCCGCCGC
GGCGCACGCGCCCTTCATCTCTGCCGCGTCTGAATCGATGTTCGGTCTGGAAACCTTCACCGACCTGGGTAAACCGCGCG
ATTTGGCCAAGGTGTTCGACACTGTCGAATACGCCAAGTGGAAGTCGTTCCGTGAGTCGGAGGATAGCCGCTACGTCGGC
CTGACCATGCCGCGTTTTCTCGGGCGGCTGCCGTACAACCCGAAGGACGGCACTACGGTCGAAGGCTTCAACTTCGTCGA
AGACGTCGACGCTGCCGACCATAGCAAGTATCTGTGGTGCAACACCGCTTATGCGATGGCCACGCGCCTGACCAAGGCGT
TCGAGGACTACGGTTGGTGCGCGGCGATCCGCGGTGTGGAAGGCGGTGGCCTGGTCGAAGACCTGCCGACCCACACCTTC
CGCACCGACGACGGCGAAGTGGCGCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAGCTCAGCGA
CCTGGGCTTCATCCCGCTGGTACATTGCAAGAACACCGACTACGCGGCGTTCTTCGGTGCGCAGTCGGCGCAGAAGCCGA
AGAAGTACAACACCAATGCGGCCAATGCCAACGCGATCCTGTCGGCGCAGCTGCAGTACATGTTCGCCGTGTCGCGTATC
GCCCATTACCTCAAGGCGATGATGCGCGAGAAGATTGGCAGTTTCGCCTCGGCGCGTAATGTCGAGGATTTCCTGAACCG
TTGGATCTCCCAGTACGTGTTGTTGGACGACAACGCCGGTCAGGAAGCAAAGGCGCAATACCCCTTGCGGGAAGCGTCCG
TACAAGTTTCGGAAGTGCCGGGGAAACCCGGTGTCTACCGCGCGGTGGCCTTCATCAGGCCGCATTTCCAGCTCGATGAG
CTGTCTGTTTCGTTGCGTCTGGTGGCCGAACTGCCGGCTGGTACCAAGAAGGCGTAG